(data stored in ACNUC7421 zone)

EMBL: CP001700.PE435

CP001700.PE435       Location/Qualifiers
FT   CDS_pept        488883..491351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69390.1"
FT                   /translation="MTRIVPDDARAALADFIEAVAPAELSAEEIAEALWLAQWINQSAG
FT                   ATAGSAEPQQESGQEAPPPHRVPVSIPRTPAGRQQPARAHPPATVADAESEPERRTSPP
FT                   PRLMGSALIRVPSPTGSEAVRFARSLRRLRPLPVRRAPGTADAAATVDEAETARFAAET
FT                   GLLWPVYTRQRPRRGVAKVVVDTSVSMQVWEGLEEDIVRGLSLSRVFRRVETWSLYQRG
FT                   ETAVVCERRAGVAAGHEGPLARLADGSGDGAVLILSDGVARLWYDGAVLDAVDRLAVQG
FT                   PVALVQPLPNRLWRRTGLRPRLTTVTGTARGPEALHLTRVAIGTAAPAVPIIEADESWF
FT                   ATWAALASGRLATARFAVLGSRSPAGYAQSVAAGGVQEPGQLVGDGMAVPVVRRFRAAA
FT                   SQGARELAAALSVVPLSLPIMQMVLATCFPDRSRAHLAEVITGGLMQRDPKVPEGGGPP
FT                   AFRWLPGVGEELRREVDDRQAERVRAALSGYLDAELGFRPDSRGFIAIMGTPAMPAERE
FT                   GRFGSPFARILPDTVRRALNHAGVAYTVSDTVGTASEAQRITHALALAEAARNTGRSAE
FT                   IDEAIEAARLAVSEAAGRDWPLTDALAELLEHRGRREGSPFDAEEAVIVLREYVDRAPA
FT                   DDPHRQEGLERLADALLARYQSTESPDDLDDAIRMRRRLAEAEDAAQDQLVLLADALLE
FT                   HHRLTGASLSAYEATDLMSGLRRTGQSEGVRVAATAILARGLDIMSRSTRAEEDIEASD
FT                   AVWLALMPELGELTEDQAAVTRTAIEARIRFHKSSGRAGRARALEAAYEDALGRLGQQW
FT                   GLPGAQASAI"
     gtgacccgca tcgtgccgga cgacgcgcgg gcggcgctcg cggacttcat cgaggcggtg        60
     gcgccggcgg agctgtcggc tgaggagatc gccgaggcgc tgtggctggc gcagtggatc       120
     aaccagtccg cgggcgcgac agccggctcc gccgagccac agcaggaatc cggtcaggag       180
     gcgccgcctc cacaccgcgt tccggtgtcg attcccagaa cccccgccgg acgccagcag       240
     cctgcccgag cgcacccgcc ggccaccgtc gccgacgccg aatcagagcc cgagcgccgc       300
     acctcgccac ccccgcggct catgggatcg gcgctgatcc gcgtgccctc gccgaccggg       360
     tcggaggcgg tgcgcttcgc ccgctcgctg cggcgcctgc ggccgctgcc ggtccgccgc       420
     gcccctggca cggcggacgc cgccgcgacc gtggacgagg cggagacggc gcgcttcgcg       480
     gcggagaccg ggctgctctg gccggtctac acgcgccagc gtccccggcg cggcgtcgcg       540
     aaggtagtcg tcgacacctc ggtgtccatg caggtgtggg aagggctcga ggaggacatc       600
     gtcagaggcc tgtcgctgtc gcgcgtcttc cgcagggtcg agacgtggtc cctgtaccag       660
     cgcggcgaga cggctgtggt gtgcgaacgc agagccggag tcgccgccgg gcacgaaggt       720
     cccctggcac ggctcgccga cgggtccggg gacggcgccg tcctcatcct gtccgacggc       780
     gtcgcaaggc tctggtacga cggcgccgtg ctggacgccg tcgatcgcct cgccgtccaa       840
     ggtcccgtcg cgctcgtcca gccgctgccg aatcggctgt ggcgccggac agggctccgt       900
     ccgaggctga cgacggtcac cggaaccgcc cgaggtcccg aagccctgca cctgacgcgc       960
     gtcgcgatcg ggaccgcggc gccggcggtc ccgatcatcg aggcggacga gtcctggttc      1020
     gccacctggg ccgcactggc atccgggcgc ctggcgacgg ctcgcttcgc ggtgctcggc      1080
     tcccgatcgc ccgccggcta cgcgcagtcg gtggcggcgg gcggcgtcca ggaacccggc      1140
     cagctggtcg gcgacggaat ggcggtcccg gtcgtccgcc gcttccgcgc cgccgcgagt      1200
     cagggcgcgc gcgaactggc cgccgcgctg tctgtcgtgc cgctcagtct gccgatcatg      1260
     cagatggtcc tcgccacctg cttccccgac cggagccgcg cgcacctggc cgaggtgatc      1320
     accggcggcc tgatgcagcg cgatcccaag gtcccggaag gcggcggccc gccggcgttc      1380
     cgctggctgc ccggcgtcgg cgaggagctg cgccgggagg tggacgaccg ccaggccgaa      1440
     cgcgtgcgcg ccgcgctgtc gggctacctg gacgccgagc tcgggttccg gccggactcg      1500
     cgcggcttca tcgccatcat gggcacgccc gcgatgccgg ccgagcggga gggacggttc      1560
     ggtagtccat tcgcgcggat tctgcccgac acggtccgcc gggccctgaa ccatgccggc      1620
     gtcgcctata ccgtgtccga cacggtgggt accgcttcgg aagcacagcg catcacgcac      1680
     gccctggctc tggccgaagc ggcccggaac actggacgga gtgcggagat cgacgaggcc      1740
     atcgaggcgg cgaggctggc ggtgagcgag gccgcaggcc gggactggcc gctgaccgac      1800
     gcgctggccg agctgctcga gcaccgcggc cgtcgcgagg ggtcgccgtt cgacgccgag      1860
     gaggcagtca tcgtcctgcg cgagtacgtc gaccgggcgc cggcggacga cccgcaccgc      1920
     caagagggtc tggaacgcct cgccgacgcc ctgctggcgc ggtatcagag caccgagtcg      1980
     cccgacgacc tcgacgacgc catccggatg cgccgccggc tcgccgaggc cgaggacgcc      2040
     gcccaggacc agctggtgct cctcgccgac gccctgctcg agcaccaccg gctcaccggc      2100
     gcctcgctgt ccgcctacga ggcgaccgat ctgatgagcg gtctgcgccg caccggccag      2160
     agcgagggcg tgcgcgtcgc cgccaccgcg atcctggccc gcgggctgga catcatgagc      2220
     cgctcgacac gcgccgagga ggacatcgag gcctccgacg cggtgtggct cgcgctcatg      2280
     ccggaactcg gcgagctgac cgaggaccag gccgccgtca cgcgcaccgc gatcgaggcg      2340
     cggatccggt tccacaagag ttcggggcgc gccgggcgtg cgcgcgccct ggaggccgcg      2400
     tatgaagacg ccctgggccg tctggggcag cagtggggtc tgccgggagc gcaggcctcc      2460
     gcgatctga                                                              2469
//

If you have problems or comments...

PBIL Back to PBIL home page