(data stored in ACNUC7421 zone)

EMBL: CP001700.PE436

CP001700.PE436       Location/Qualifiers
FT   CDS_pept        491560..491793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69391"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69391.1"
FT                   /translation="MERTITAALETDGSAAGVDVSGFAAGHDLAWTEPGPETVPSPLAR
FT                   GMQRLLAEYVQETEWVVGWSSCLLPPPPDRAP"
     ttggaacgca cgatcaccgc ggccctcgaa accgacgggt cggccgcggg cgttgacgtc        60
     tccggtttcg ccgccggcca cgacctggcc tggaccgaac cgggaccgga gacggtccct       120
     tcgccgctgg cccgggggat gcaacggctg ctggccgagt acgtgcagga gaccgagtgg       180
     gtcgtcggct ggagttcctg cctgctgccc ccgccgccgg accgggcgcc ttga             234
//

If you have problems or comments...

PBIL Back to PBIL home page