(data stored in ACNUC7421 zone)

EMBL: CP001700.PE437

CP001700.PE437       Location/Qualifiers
FT   CDS_pept        491790..492959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0440"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   fre:Franean1_5726 radical SAM domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69392"
FT                   /db_xref="GOA:C7PX41"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026335"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX41"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACU69392.1"
FT                   /translation="MSLDTGAGLPRPARAGWTATGLRQFVLKLHSRCNLACSYCYIYEG
FT                   PDQSWRDKPGTMSPETIALTASRIAEHVATHRPPWIEVVLHGGEPLMAGLPVLRNAAET
FT                   IRAAVPDTTAVRLIVQTNGLLLTEQMLEGLDALGILVAVSIDGSASDNDRRRRFRDGRG
FT                   SFDAVSTGLRMLTSERFRHLFVGFLCVIDLESDPLAVYEALTVWDPPTVDLLLPHRTWA
FT                   DPPPPGARYAAWLSEVFDHWYRSGSATGIRVFDEIIAVLLGARTGTTAIGAGPVQHVTV
FT                   ETDGSLEADDILKIAYAGAPETGLTLARHSFDDYLATPALMDRRSGIDALCRECRECPI
FT                   VGVCGGGTYPHRFRPGHGFANPSAYCHDLMAVISHIKEAIIGDLSGRPA"
     ttgagcctcg acaccggcgc ggggctgccg aggccggcgc gagccggctg gacggcgacg        60
     ggactgcggc agttcgtgct caagctgcat tcccgctgca acctcgcctg cagctactgc       120
     tacatctacg aaggtcccga ccagagctgg cgggacaagc cgggcacgat gagcccggag       180
     acgatcgccc tgaccgcctc ccggatcgcc gagcacgtcg cgacccaccg tccgccctgg       240
     atcgaggtgg tcctgcacgg cggcgagccg ttgatggccg ggttgccggt gctgcgcaac       300
     gccgccgaga cgattcgcgc cgccgtcccg gacaccaccg ccgtccggct catcgtgcag       360
     accaacggct tgctgctgac cgagcagatg ctcgaagggc tcgacgccct cggcatcctg       420
     gtcgcggtca gcatcgacgg atcggcctcg gacaacgatc ggcggcgccg cttccgggac       480
     ggtcggggca gcttcgacgc ggtctcgaca gggctgcgga tgcttacctc ggaacgcttc       540
     cgccacctgt tcgtcggctt cctgtgcgtc atcgacctgg agtccgatcc gctggccgtc       600
     tacgaggcgc tcaccgtctg ggacccgccg accgtggatc tgctgctccc acaccggacc       660
     tgggccgatc cgccgccgcc cggcgcgcgc tacgcagcct ggctctcaga ggtcttcgat       720
     cactggtacc gctcgggcag cgccaccggc atccgcgtct tcgacgagat catcgcggtc       780
     ctgctcggcg cccgcaccgg cacgacggcg atcggtgccg gaccggtcca gcacgtcacc       840
     gtggagaccg acggatcgct cgaggccgac gacatcctta agatcgctta tgccggcgcg       900
     ccggagaccg gactgactct cgcccgccat agtttcgacg actatttggc aacaccggca       960
     ttaatggatc ggcgaagcgg aatcgacgca ctgtgccgtg agtgccgcga gtgcccgatt      1020
     gtcggagttt gtggcggcgg aacctatcca caccgctttc gccccggtca cggcttcgcc      1080
     aacccgtcgg cttattgtca tgacctaatg gcggtcatca gccatatcaa agaggcgatc      1140
     atcggcgatc tatcaggtcg tccggcatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page