(data stored in ACNUC7421 zone)

EMBL: CP001700.PE438

CP001700.PE438       Location/Qualifiers
FT   CDS_pept        493087..496119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5712 ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69393"
FT                   /db_xref="GOA:C7PX42"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX42"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69393.1"
FT                   /translation="MVLHSAIPGVRDALVVHCDADETWVSWIDEALADQGFQTHRLSWT
FT                   ADGEDLGRTIGDVLGGGVSCCVVVLSEAFLAAADYSPQQWRTALRDSADLLDRLFPVVV
FT                   DRAQLPAELPLEVRQQIIDISDVGEQAARERLIQAVSGEPPVGRVPVRTREGKVRTRFP
FT                   ASDPAIWCPWTPNRNFSFVGRDKELKALHARLWDAPRGQARVAVTGLGGVGKSQIAVEY
FT                   MYRYQSEYDAVWFVRATRTAIARQDVVNVGAELGAPSADDLQAGIDGALRALLEDARTR
FT                   RWLVVIDDARSAAAVKDLLPSFPGQHGHVIITSTDENWTDIAAELPIQPMSAEESFRYL
FT                   RSRLPETGDEDLQALVGYCDGLPIAMDLAAAQVRGAAQSVRAFLQSASERGVDQYQVKL
FT                   GRHEKTVAQTYLTALDSVGREVPAAGELLRLLSFMASAPIPIRLFGALSQDSGLPELAD
FT                   LAQVSRGFADSSALLGMLSEIRKHSLATIGLQGEESVISMHRVPQRVIVADIAEDQALR
FT                   YRHAVHLMLRARDIGAARTSAQWLVMLEIWRNLESSDGWDCELCAADISCRQMMLHVIR
FT                   ALMIWSESTQCEAAAARAIAAWTPVLGPHHTDVREATLERANALRNMGRAGEALELDEA
FT                   LARDVAEMPDVRPAIAIRTGLNRGGDLRRLGRFADASTIDTQTRDRAVDEFGEIDRLSL
FT                   MARGNVSVSYLLLGEAANAMRNDEDLVRDQVRLRGDGDRAAFQTRTRIARAHRDMGQYR
FT                   SAVEMQEHNTYRCERVFGPHDATTLTAKGTLASCLRKAGQYEEARRVASTTVTDLQKLI
FT                   GDRHPEMVLAMTELANCLVRTDRRADAAELGRQALMLAVEVCGTDHPFTAICQNNLALV
FT                   HLVQHEPFEAETLLNEAAQVFAALPTDHPHQLIVAANLATALWDRGEYTKAEDLEKQLE
FT                   PKFVQALGENHPTTLAVASNRVTTFDALAGDDATRRTINNARWRRTVAAYQRVLTREHP
FT                   DVQIAEERRRRIHIALDAPAV"
     gtggtgctgc acagcgcgat ccccggcgtc cgtgacgccc tcgtcgtcca ctgcgatgcg        60
     gacgagacgt gggtgtcgtg gatcgacgag gcgctcgccg accaagggtt ccagacgcac       120
     cggctgtcct ggacggccga cggcgaggat ctgggccgga cgatcgggga tgtgctcggc       180
     ggcggcgtca gctgctgcgt cgtggtgctc agcgaggcgt tcctggccgc cgccgactac       240
     tcgccccagc agtggcgcac cgcgctgcgc gacagcgccg acctgctcga ccggctgttc       300
     ccggtggtcg tggaccgcgc gcagctgccg gccgaactgc cgctggaagt gcgccagcag       360
     atcatcgaca tctcggacgt cggcgagcag gcggcgcgcg aacgcctgat ccaggcggtc       420
     tccggcgagc cgccggtcgg gagggtcccg gtgcgcacgc gcgaaggcaa ggtccgcacc       480
     cggttcccgg ccagcgatcc ggcgatctgg tgtccgtgga cgcccaacag gaacttctcc       540
     ttcgtgggcc gggacaagga actcaaggct ctgcacgccc ggctgtggga cgcgccgcgc       600
     gggcaggcgc gggtggcggt caccgggctc ggcggcgtcg gcaagtcgca gatcgccgtc       660
     gagtacatgt accgctatca gagcgagtac gacgcggtgt ggttcgtgcg cgcgacccgg       720
     accgcgatcg cccggcagga cgtcgtcaac gtcggcgcgg agctcggcgc cccgagcgcg       780
     gacgacctgc aggccggtat cgacggcgcc ttgcgcgcgc tgctcgagga cgcgcggacg       840
     cggcgctggc tcgtcgtgat cgacgacgcc cgctccgccg ccgcggtgaa ggacctgctg       900
     cccagcttcc ccggccagca cggccacgtc atcatcacct cgacggacga gaactggacg       960
     gacatcgccg ccgagctccc gatccagccg atgtccgccg aggagagctt ccgctatctg      1020
     cgctccaggc tgccggagac cggcgacgag gacctgcagg ctctggtcgg gtactgcgac      1080
     ggtctgccga tcgccatgga cctggccgcc gcgcaggtgc ggggcgcggc gcagtcggtg      1140
     cgggcgttcc tgcagtcggc gtccgagcgc ggcgtcgacc agtaccaggt caagctcgga      1200
     cgccacgaga agacggtcgc gcagacctat ctgaccgcct tggacagcgt gggccgcgag      1260
     gtccccgccg ccggcgagct gctgcgcctg ttgtccttca tggccagcgc cccgatcccg      1320
     atccggctgt tcggcgcgct gagccaggac agcggtcttc cggaactggc cgacctcgcg      1380
     caggtttccc gcggattcgc ggactcctcg gcgctgctcg ggatgctcag cgagatccgc      1440
     aagcactcgc tggcgaccat cgggctccag ggcgaggaat cggtcatctc catgcaccgg      1500
     gtcccgcagc gggtcatcgt cgccgacatc gccgaggacc aggcgctgcg ctaccgccac      1560
     gcggtccacc tgatgctgcg cgcccgcgac atcggcgccg cgcggacgtc ggcgcagtgg      1620
     ctggtgatgc tggagatctg gcgcaacctg gagtcctcgg acggctggga ctgcgagctg      1680
     tgcgccgcgg acatctcctg ccggcagatg atgctgcacg tcatcagggc tctgatgatc      1740
     tggagcgagt cgacgcagtg cgaggcggcc gccgcccgcg ccatcgcggc gtggacaccg      1800
     gtcctgggcc cgcaccacac cgacgtccgc gaagccacgc tggagcgcgc gaacgcgttg      1860
     cgcaacatgg gccgggccgg cgaagcgctg gagctggacg aggcgctggc ccgcgacgtc      1920
     gccgagatgc cggacgtacg cccggcgatc gcgatccgca ccggtctgaa ccggggcggc      1980
     gacctgcgcc gcctgggccg gttcgcggac gcgagcacca tcgacacgca gacccgggac      2040
     cgggccgtcg acgagttcgg cgagatcgac cggctcagcc tcatggcccg cggcaacgtc      2100
     tcggtgtcct acctcctgct cggcgaagcc gcgaacgcca tgcggaacga cgaggacctg      2160
     gtccgcgacc aggtgcgcct gcgcggcgac ggcgaccggg cggcgttcca gacccgcacc      2220
     cgcatcgccc gcgcgcaccg cgacatgggg cagtaccgca gcgccgtgga gatgcaggag      2280
     cacaacacct accgctgcga gcgggtgttc ggtccccacg acgcgaccac cctgacggcg      2340
     aagggcaccc tcgccagctg cctgcgcaag gccggccagt acgaggaggc gcgccgcgtc      2400
     gcctccacga cggtgaccga cctgcagaag ctgatcggcg accggcaccc ggagatggtg      2460
     ctggcgatga ccgagctggc caactgcctc gtccgcaccg accgccgcgc cgacgccgcc      2520
     gaactgggcc gccaggcgct gatgctcgcg gtggaggtct gcggcaccga ccaccccttc      2580
     accgccatct gccagaacaa cctcgccctg gtccacctgg tgcagcacga gcccttcgag      2640
     gccgagaccc tgctgaacga ggcggcgcag gtcttcgccg cactgccgac cgaccacccg      2700
     caccagctga tcgtcgcggc gaacctggcc accgccctct gggaccgcgg cgagtacacg      2760
     aaggccgagg acctggagaa gcagctcgag cccaagttcg tccaagccct cggcgagaac      2820
     cacccgacca ccctggccgt cgcctccaac cgcgtcacca ccttcgacgc cctcgccggc      2880
     gacgacgcca cccgccgcac catcaacaac gcccgctggc ggcgcacagt cgcggcgtat      2940
     cagcgggtcc tgacccgcga gcacccggac gtgcaaatcg cggaggaacg gcggcgccgg      3000
     atccacatcg cgctggacgc tccggcggtg tag                                   3033
//

If you have problems or comments...

PBIL Back to PBIL home page