(data stored in ACNUC7421 zone)

EMBL: CP001700.PE439

CP001700.PE439       Location/Qualifiers
FT   CDS_pept        496241..497434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_7062t hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69394"
FT                   /db_xref="GOA:C7PX43"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX43"
FT                   /inference="similar to AA sequence:KEGG:SGR_7062t"
FT                   /protein_id="ACU69394.1"
FT                   /translation="MGQDSQNSDSLGRRRAPALARWPLGRVAFATFCATLALALGVLAG
FT                   VLGWLGLLSRSSFRSSPGTALDVVKLVLGAVAGVGALVGLVIAYRRQLVAETADDRERT
FT                   RLFNERFNAAAEQLGSDRAGVRQAGIYSMEGLADDWPAGRQKCVDVLCALARRGHVLQP
FT                   PADAPIEDRLAWDDDRQFRHAIMRVVADHLRPAAAVPWRGGNFDFTGALVDGGDFEGIE
FT                   LTGGRLVFAGARFVAGAPLVLRGSRIDGGLLDVRGAVFDSGALDLSKASVGPQATVNFS
FT                   DVLFQDGYIDIRTTTIEGCCYLCRATMSGAEIELSESSLRGTIDFRDARLAGGVMRFDG
FT                   AVVAPERFRFAGARFEGATLDFSGAQVDGLLDFGTAASPTGVMLPPTPTVAPHSAPE"
     gtgggccagg attcacagaa ctctgattca ctcggccgcc ggcgggctcc cgcgctcgcc        60
     cggtggccgc tcgggcgggt cgcgttcgcc acgttctgcg cgaccttggc gctggctctc       120
     ggcgtgctcg ccggggtgct ggggtggctc gggctgctgt cgcgctcctc gttccggtcc       180
     tcgccgggga cggcgttgga cgtcgtcaag ctcgtcctcg gcgcggtcgc cggcgtcggc       240
     gcgctggtcg ggctggtcat cgcctaccgg cggcagctgg tcgccgagac cgccgacgac       300
     cgggagcgca cccgcctttt caacgagcgc ttcaacgccg ccgccgagca gttgggctcg       360
     gaccgggccg gggtgcggca ggcgggcatc tactcgatgg aggggctcgc cgacgactgg       420
     cccgccggcc ggcagaagtg cgtcgacgtc ctgtgcgcgc tcgcgcggcg cggccacgtc       480
     ctgcagccgc cggcggacgc gccgatcgag gaccgcctgg cctgggacga cgaccgccag       540
     ttccggcacg cgatcatgcg ggtcgtcgcc gaccatctgc ggccggccgc ggcggtgccg       600
     tggcggggcg ggaacttcga cttcaccggc gcgctcgtcg acggcggcga cttcgagggc       660
     atcgagctga ccggcggccg gctggtcttc gccggcgcgc ggttcgtggc cggggcgccg       720
     ctggtgctgc gcggcagccg gatcgacggc gggctgctgg acgtccgcgg cgcggtcttc       780
     gactccggcg ccctggacct gagcaaggcc tcggtcggac cgcaggccac ggtgaacttc       840
     agcgacgtgc tgttccagga cggctacatc gacatccgga cgaccaccat cgaaggctgc       900
     tgctatctgt gccgcgcgac catgagcggc gccgagatcg aactctcgga gtcctcgctg       960
     cgcgggacca tcgatttccg ggacgcgcgg ctggccggcg gtgtgatgcg gttcgacggc      1020
     gcggtggtgg cgccggagcg gttccgcttc gccggcgcca ggttcgaggg cgcgacactg      1080
     gacttctccg gtgcccaggt cgacggcctg ttggatttcg gtaccgccgc ctcgccgacc      1140
     ggcgtgatgc tgccgccgac accgactgtt gcgccgcact cagcccccga gtag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page