(data stored in ACNUC7421 zone)

EMBL: CP001700.PE44

CP001700.PE44        Location/Qualifiers
FT   CDS_pept        complement(45480..46550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0044"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ace:Acel_0013
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68999"
FT                   /db_xref="GOA:C7QFR0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR0"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACU68999.1"
FT                   /translation="MPPGSPGSPSVPATELPACYRHPGREAQIRCTRCDRRICPECMVP
FT                   ASVGFQCPECVRGGNQEVRKARSPFGAVLRPRVVPVVTYSLIALNFVMFGLQHIVGTSQ
FT                   VGAAGGGVFQVNTLDMRLELIAKGTWVDGQPIGVANGEWYRLVTSMFLHANLIHIASNM
FT                   ISLFFIGPMLEAMLGRLRFVLVYLIGGLAGAVTSYWFMTPLSPASLGASGAISAVFGCL
FT                   VVIGLRRKILDPGMIAVVLVINIVIPLQNTNIDWRDHVGGVVAGALIGAVYAFAPELIG
FT                   ALGKARAPREQQVRLLNWLGFGTMALVLALAIGGTAVHTAHLNDPANRTRTVDGAVYSP
FT                   GPTRVVTDVPTSYPQA"
     atgccgccag gcagcccagg cagcccctcc gtgccagcca ccgaactccc ggcgtgctac        60
     cggcatccgg gccgcgaggc gcagatccgc tgcacccgct gcgatcgccg gatctgcccg       120
     gagtgcatgg tcccggcctc ggtcgggttc cagtgcccgg agtgcgtgcg cggcggcaac       180
     caggaggtgc gcaaggcgcg gtccccgttc ggggcggtgc tgcgcccccg ggtggtcccg       240
     gtcgtcacct acagcctgat cgcgctgaac ttcgtgatgt tcggcctgca gcacatcgtc       300
     ggcacctcgc aggtcggcgc ggccggcggc ggggtgttcc aggtgaacac cctggacatg       360
     cggctggagc tgatcgccaa gggcacctgg gtcgacggcc agccgatagg cgtggccaac       420
     ggcgagtggt accgcctggt cacctcgatg ttcctgcacg cgaacctgat ccacatcgcc       480
     tcgaacatga tctcgctgtt cttcatcggc ccgatgctgg aggcgatgct cggccggctg       540
     cggttcgtgc tggtctacct gatcggcggc ctggccgggg cggtcacgtc ctactggttc       600
     atgaccccgc tgagcccggc gagcctgggc gcctcgggcg ccatctcggc ggtcttcggc       660
     tgcctggtgg tgatcgggct gcggcgcaag atcctggacc ccgggatgat cgccgtggtg       720
     ctggtgatca acatcgtgat cccgctgcag aacaccaaca tcgactggcg cgaccatgtc       780
     ggcggcgtgg tggccggggc gctgatcggc gcggtctacg ccttcgcccc ggagctcatc       840
     ggcgcgctcg gcaaggccag ggcgccacgc gagcagcagg tacggctgct caactggctc       900
     ggcttcggca cgatggcgct ggtcctggcc ctggcgatcg gcggcacggc cgtgcacacc       960
     gcccacctga acgacccggc gaaccggacg cgcaccgtcg acggcgccgt gtactcaccc      1020
     ggcccgacca gggtcgtcac cgacgttccg acaagttatc cacaggcctg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page