(data stored in ACNUC7421 zone)

EMBL: CP001700.PE440

CP001700.PE440       Location/Qualifiers
FT   CDS_pept        497445..498017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69395"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX44"
FT                   /inference="similar to AA sequence:KEGG:SAV_624"
FT                   /protein_id="ACU69395.1"
FT                   /translation="MSEIPNEPASANRPFTEFLRAHGAADMPHPGGTLLAHLIRVSDRL
FT                   AEWGVPLAVQVAGLCHATYGTDGFAPSLLDLADRAILVELIGEGAEALVYRYASCDRSA
FT                   TYPRLRGGEQPVFRDRFAGADCQPTGEELRAFLDITAANELDVFRHNAELADRHAPAFY
FT                   RLLESVRALMSPAAWDAVRGDLGDRAS"
     gtgagcgaga ttccgaacga acccgcatcc gccaaccgtc ccttcactga gttccttcgt        60
     gcccacggcg ccgcagacat gccgcacccc ggcggcacgc ttctggcgca cctcatccgc       120
     gtgagcgatc ggctcgcgga atggggtgtg ccgcttgcgg ttcaggtcgc aggcctctgc       180
     catgcgacgt acgggaccga cgggttcgcc ccgtccctgc tggatctggc cgatcgcgcg       240
     atcctggtcg agctgatcgg cgagggcgct gaggctttgg tctaccgtta cgccagctgc       300
     gatcgctctg ccacctaccc gcggttgcgc ggcggtgagc agccggtctt ccgggaccgg       360
     ttcgccggcg ccgactgcca accgaccggt gaggagctgc gtgccttcct cgacatcacc       420
     gcggcgaacg agctggatgt gttccggcac aacgcggaac tggccgatcg tcatgctccg       480
     gcgttctatc ggctgctgga gtctgttcgt gccctgatgt cccccgccgc atgggatgcg       540
     gtgcggggcg atctcggaga tcgcgcctcg taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page