(data stored in ACNUC7421 zone)

EMBL: CP001700.PE441

CP001700.PE441       Location/Qualifiers
FT   CDS_pept        498312..500072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0444"
FT                   /product="Ricin B lectin"
FT                   /note="PFAM: Ricin B lectin; SMART: Ricin B lectin; KEGG:
FT                   sus:Acid_7414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69396"
FT                   /db_xref="GOA:C7PX45"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX45"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ACU69396.1"
FT                   /translation="MKISPRRLITALAALCLGIGAALGMIAAPAQAAASATSEQTFLTF
FT                   YGWWDNTPPGADIAYPQIHQTAGGTGTYADPITFATDSNEQPPGTIVYVPRVGKYFIME
FT                   DGCDECSSDWTGHGPNGGPNLRHLDLWLGGKGGNAFDAIECEDALTNYNSDGTPTMEPV
FT                   IVNPPSNETVSSSPIFNTSTGACYGGAKPTISVGQYKNVSTGNCMTDPNNSSSAGALLV
FT                   TAACDSTAASQRFTFDGTFLQINNLCADYSTSQISMQKCTAGPSQQWSYNTDLTFTDIQ
FT                   TGKKYINDSSGKVKSGSSSSSTKTWTYVPAGSGTTNDFSVAASPASASVTAGGTATATV
FT                   STAVTAGAAESVALSASGGPAGSTVSLSPTNVTSGGSSTLSVATTSTTAPGTYTITVTG
FT                   KAATGTHTATYTLTVNPVSGGGGCTAAQLLTNPGFESGASTGWTGSSTLGFNPITNSTS
FT                   GEPTHAGSWESWFNGNGSADTDTVAQSVTIPSGCTATLSYWLHIDTTESTSTAKPDTFS
FT                   VQLLNSSGTVLTTLATYSNLDKASGYTQHSSDVSAYAGQTVKLRFTGTETDKNGGTTSF
FT                   VLDDTALNAK"
     atgaagatat ccccgcggcg cctcatcacg gcgctcgcag ccctctgtct gggcatcggc        60
     gcggccctcg gcatgatcgc cgcgccggct caggcggcgg cgtcggccac cagcgagcag       120
     accttcctga ccttctacgg ctggtgggac aacacgccgc ccggcgccga catcgcctat       180
     ccgcagatcc accagaccgc gggcggcacc gggacgtacg ccgatccgat caccttcgcc       240
     accgactcca acgagcagcc gccgggaacg atcgtctacg tcccgcgcgt cggcaagtac       300
     ttcatcatgg aggacggctg cgacgagtgc agctcggact ggaccggcca cggtcccaac       360
     ggcggtccca acctgcggca cctggacctg tggctcggcg ggaagggcgg caacgccttc       420
     gacgccatcg agtgcgagga cgcgctgacc aactacaaca gcgacggcac gccgaccatg       480
     gagccggtga tcgtcaatcc gccgtcgaac gagacggtgt cctcctcgcc gatcttcaac       540
     accagcaccg gcgcgtgtta cggcggtgcg aagccgacga tctccgtcgg gcagtacaag       600
     aacgtctcga ccggcaactg catgaccgac ccgaacaaca gctcctcggc cggcgcgctg       660
     ctggtgacgg ccgcctgtga cagcaccgcg gccagccagc gcttcacctt cgacggcacg       720
     ttcctgcaga tcaacaacct ctgcgcggac tactcgacct cgcagatctc gatgcagaaa       780
     tgtaccgccg gacccagcca acagtggtcg tacaacaccg acctgacgtt caccgacatc       840
     cagaccggca agaagtacat caacgactcc tcgggcaagg tcaagtcggg cagcagctcc       900
     agcagcacga agacctggac ctacgtcccg gccggctccg gcacgacgaa cgacttctcc       960
     gtggcggcca gcccggcgag cgcctccgtc accgccggcg gcaccgcgac cgcgacggtc      1020
     tccaccgccg tgaccgccgg tgccgctgag tccgtcgcgc tgagcgccag cggcggcccg      1080
     gccggctcca cggtcagcct gagcccgacc aacgtcacct ccggcggcag ctcgaccctg      1140
     agcgtcgcga ccacctccac gaccgccccc gggacgtaca ccatcacggt caccggtaag      1200
     gctgcgaccg gtacccacac cgccacctac acgctgacgg tgaaccccgt ctccggaggg      1260
     ggcggctgca ccgcggccca gctgctgacc aaccccggct tcgagagcgg cgccagcacc      1320
     ggctggaccg gcagctccac cctgggcttc aacccgatca ccaacagcac cagcggcgag      1380
     ccgacgcacg cgggctcctg ggagtcctgg ttcaacggca acggctcggc cgacacggac      1440
     accgtcgcgc agtcggtgac catcccgtcg ggctgcaccg cgaccctgtc ctactggctg      1500
     cacatcgaca cgaccgagag cacgtcgacg gccaagccgg acaccttcag cgtgcagctg      1560
     ctcaactcct cgggcaccgt gctcaccacg ctggccacct acagcaatct ggacaaggcc      1620
     agcggctaca cccagcacag cagcgacgtg tcggcctacg cgggtcagac cgtcaagctc      1680
     cgcttcaccg gcaccgagac cgacaagaac ggcggcacca ccagcttcgt cctcgacgac      1740
     acggcgttga acgcgaagta g                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page