(data stored in ACNUC7421 zone)

EMBL: CP001700.PE442

CP001700.PE442       Location/Qualifiers
FT   CDS_pept        500344..502587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A5663 DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69397"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69397.1"
FT                   /translation="MRKHTSRAARAAALCAAAAAVATFTVPAQGAVGATPQATPVPSTT
FT                   SRVTLATGDTVELSPAGTRVLPGGPSKAFTTFTDTKGDTYIVPAEAVPFAGRVLDMSLF
FT                   DVTRLAAMAQGAQGSQIPVSLAFQAGVTPSAPAGVTLTAVSGQTATGYMTPASGAALAT
FT                   ALQKQIAADKTAGRTVGSGGLLGLTSMRVAGTGTPVTPNYPMRILQINALDTDGAPLDS
FT                   YVTLINTDNSQIMAVSEPVVGGVARIALPAGNYAAYMSDFSYDTSGYITGEALVAVNDF
FT                   AVPATGDVPALTLDARTATAPVSVTTQQSSTAQNLMQQMTRTPTTGPTVVLGSFFIFTG
FT                   GMPLTMTPQATAKVGKFTLDTVEDMAGPAGAGPDNYQYQYFLDFPSDHIDADQSHHPAD
FT                   RDLAAETENIDSDPALAGAERGVDAAPVLPYTGPGLQFGAAMPQKSTSYFTPGRWANGI
FT                   SGPWASGPGQPEGPSLWSGAKTYHAGQVSQHTWGAAPSAPAFGRYQESAAEVDCQVCVG
FT                   AGNMDLEFYDAGDSNPDTVGVDFDANPSATFYWNGQPLTPPSGPPGFSSPDIIVPNVGT
FT                   TPATVRAVLDTDRTSGEKQSTNTHTDVTFQYTGKTDSRSTLPDGNYCPAAIAAGQPSAP
FT                   CQIMPVMTIGYQYGALSRTNVSQSPVQSLVLDIGHHSFGGHGSLAPVVSAKVSVSFDSG
FT                   ATWQDVPTVGAFGHYAALWHNPAPGTPVAVRVTAADSIGGSISQTVTNPYTVG"
     gtgcggaaac acacatcacg cgctgctcgt gccgcagcgc tgtgcgcggc ggcggcagcc        60
     gtcgccacct tcaccgtccc ggctcagggc gccgtcggcg ccacacccca ggcgactccg       120
     gtgccctcga cgaccagccg cgtcacgctg gccaccggcg acaccgtcga gctgtccccg       180
     gccgggacgc gggtcctgcc cggcggtccc agcaaggcct tcaccacctt caccgacacc       240
     aagggcgaca cctacatcgt cccggccgag gccgtgccgt tcgccggccg ggtgctcgac       300
     atgtcgttgt tcgacgtcac gcgcctcgcg gcgatggcgc agggcgcgca gggcagtcag       360
     atccctgtct cgctcgcctt ccaagccggc gtcaccccga gcgcgccggc cggcgtcacc       420
     ctgaccgcgg tctccgggca gaccgccacc ggctacatga ccccggcctc cggcgccgcg       480
     ttggccaccg cgctgcagaa gcagatcgcc gccgacaaga cggcgggccg gaccgtcggc       540
     agcggcggac tcctcggcct cacctcgatg cgggtcgccg ggaccggaac cccggtcacg       600
     ccgaactatc cgatgcggat cctgcagatc aacgcgctgg acacggacgg cgcgccgctg       660
     gacagctacg tgacgctgat caacaccgac aactcgcaga tcatggcggt cagcgaaccg       720
     gtcgtgggcg gcgtcgcccg gatcgcgctg cccgccggga actacgccgc ctacatgagc       780
     gacttctcct acgacacgtc cggctacatc accggggagg cgctggtcgc ggtcaacgac       840
     ttcgccgtgc cggccaccgg cgacgtgccg gcgctgactc tggacgcgcg gacggccacg       900
     gcgccggtct ccgtcaccac gcagcagtcc tcgaccgcgc agaacctgat gcagcagatg       960
     acgcgcacgc cgaccaccgg accgacggtc gtcctcggat ccttcttcat cttcaccggc      1020
     gggatgccgc tcaccatgac gccgcaagcc acggcgaagg tcgggaagtt cacgctggac      1080
     acggtcgagg acatggccgg tccggcaggc gcgggcccgg acaactatca gtaccagtac      1140
     ttcctcgact tcccttcgga ccacatcgac gccgaccaga gccaccatcc cgcggaccgc      1200
     gacctggcgg cggagacgga gaacatcgat tccgatccgg ccctcgccgg cgccgaacgc      1260
     ggcgtcgacg ccgctccggt gctgccgtac accggtcccg ggttgcagtt cggggcggcg      1320
     atgccgcaga agtcgacgtc gtacttcacc cccggacgct gggcgaacgg catctccggt      1380
     ccgtgggcga gcggaccggg ccagcccgag ggaccgtccc tgtggtccgg cgcgaagacc      1440
     tatcacgcgg gtcaggtctc gcagcacacc tggggtgcgg caccgtccgc cccggctttc      1500
     ggccggtacc aggagtccgc tgccgaggtg gactgccagg tctgcgtcgg tgccgggaac      1560
     atggacctgg agttctatga cgccggtgac agcaatcccg acacagtcgg tgtcgacttc      1620
     gacgccaacc cgtcggcgac cttttactgg aacggccagc cgctgacgcc gccttcgggc      1680
     ccgcccggct tttcgagccc ggacatcatc gtgccgaacg tcggcacgac ccccgcgacg      1740
     gttcgcgccg tcctggacac cgaccgcacg tccggggaga agcagtccac gaacacccac      1800
     accgatgtga cgttccaata caccggaaag acagactccc ggtccacgct ccccgacggg      1860
     aactactgcc cggcggcgat cgctgccggc cagccgtcgg cgccgtgcca gatcatgccg      1920
     gtcatgacca tcggctacca gtacggcgcg ctgtcgcgga cgaacgtctc gcagagcccc      1980
     gtgcagtcgc tggtgctcga catcggccac cactccttcg gcgggcacgg atcgctcgcc      2040
     ccggtggtct ccgcgaaggt gtcagtgtcc ttcgacagcg gcgccacctg gcaggacgtg      2100
     ccgaccgtcg gcgcgttcgg gcactacgcc gcgctgtggc acaacccggc gcccggtacc      2160
     ccggtcgcgg tgcgggtcac cgcggccgac tcgatcggcg gctcgatcag ccagaccgtc      2220
     accaacccgt acaccgtcgg ctga                                             2244
//

If you have problems or comments...

PBIL Back to PBIL home page