(data stored in ACNUC7421 zone)

EMBL: CP001700.PE443

CP001700.PE443       Location/Qualifiers
FT   CDS_pept        502620..503858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0446"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="KEGG: bac:BamMC406_0814 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69398"
FT                   /db_xref="GOA:C7PX47"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX47"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_0814"
FT                   /protein_id="ACU69398.1"
FT                   /translation="MKTRIRILTALAAGAAAALGLAAPAVAAPTHGGGGTKPSGGTSVA
FT                   VCAAATPGHASCFARLRTDVHGGSGVRGAAAGRSKPANAAPPTGLSPADLRAAYNLPST
FT                   GGAGQTVAIVDAGAEPNIESDLAVYRATYGLPACTTANGCFQVANQRGAASPLPPDQGW
FT                   GVEIALDVDMVSAACPQCHILLVEADDASNENLAASVDTAVALGATEVSNSYGGPEASD
FT                   SAQVASHYSHPGVAILASTGDSGYQPANAPAVYGSVIAVGGTTLTRAATSRGWSESAWS
FT                   GAGSGCSAWFAKPAWQQDANCPGRMTADVSADADPNTGPAIYCTDGCPGWGVVGGTSVS
FT                   SPFLAGVVALAGHPGRFPDASYLYAHASGLNDVVGGNNSVSGMDCGGDYQCNAVADYDG
FT                   PTGLGTPNGLAAF"
     atgaaaacgc gaataagaat cctgacggca ctcgctgccg gtgcggccgc ggctctgggt        60
     ctcgccgctc cggcggtcgc ggcgccgacg cacggcggcg gcggaacgaa acccagcggt       120
     ggcacctcgg tcgcggtgtg cgcggcggcc actcccggtc acgcgagctg cttcgcccgg       180
     ctgcgtaccg acgtccacgg cgggagcggc gtgcgcggtg cggcagccgg ccgctccaag       240
     ccggcgaatg ccgcgccgcc gaccggcctg agcccggccg atctgcgcgc cgcctacaac       300
     ttgccctcca ccggtggcgc ggggcagacg gtggcgatcg tcgatgccgg cgccgagccg       360
     aacatcgaat ccgatctcgc cgtctaccgc gccacctacg gactgccggc gtgcacgacg       420
     gcgaacggct gcttccaggt ggcgaaccag cgcggcgcgg cctccccgct gccgccggac       480
     cagggctggg gtgtggagat cgcgctcgac gtggacatgg tgtcggcggc gtgcccgcag       540
     tgccacatcc tgctcgtcga agccgacgac gcctcgaacg agaacctggc cgccagtgtg       600
     gacaccgcgg tggcgctggg agcgaccgag gtgtccaaca gctacggcgg tcccgaagcc       660
     tcggactccg ctcaggtggc ctcgcactac tcccaccccg gagtcgcgat cctggcctcg       720
     accggcgaca gcggctatca gccggcgaac gccccggcgg tctacggcag cgtcatcgcc       780
     gtcggcggaa ccacgctgac ccgcgccgcg accagccgcg gctggagcga gagcgcgtgg       840
     tcgggcgccg gcagcggctg ctcggcgtgg ttcgccaagc cggcctggca gcaggacgcc       900
     aactgccccg gacgcatgac ggctgacgtc tcggcggacg ccgacccgaa cacgggacct       960
     gcgatctact gcaccgacgg ttgcccgggg tggggcgtcg tcggcgggac cagcgtctcc      1020
     tcgcccttcc tcgccggcgt cgtggcgctc gccggacacc ccgggcggtt ccccgacgcc      1080
     tcgtacctct acgcgcacgc ctccggcctc aacgacgtgg tcggcgggaa caactcggtg      1140
     agcgggatgg actgcggcgg cgactaccag tgcaacgcgg tggccgacta cgacggtccg      1200
     accggactgg ggacgccgaa cggcttggcg gctttctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page