(data stored in ACNUC7421 zone)

EMBL: CP001700.PE444

CP001700.PE444       Location/Qualifiers
FT   CDS_pept        complement(503955..505037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0447"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: stp:Strop_3846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69399"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX48"
FT                   /inference="similar to AA sequence:KEGG:Strop_3846"
FT                   /protein_id="ACU69399.1"
FT                   /translation="MRHSIIRSLAVGAVAALALGACSSGTGGSAKGRKPYIGVILPDTT
FT                   SSARWATQDQPALAAAFKAKNVKYDIQNAQGNKTQFQAIADHMLKEGVNILMIVDLDAA
FT                   TGTAVLAKARQQGVPTIDYDRLTLGGGADYYVSFDNVDVGELQGQGLVACLGGTKKPVV
FT                   AEVNGSPTDNNATLFAQGYNSVLNPLYADGTFIKGPNQSTTDWKNDIAGQNFAKMLAEA
FT                   PNIGGVLVANDGMAQAVIGVLKQHHLNGRVQVTGQDATVAGLQSVLVGDQCMTIFKDSV
FT                   KEANAAAELATALATGGSASSANTMVADSVTGKLVASVMLTPEAIVKQNVGDVISAGAV
FT                   TKAQVCTPEFAEACTANGIK"
     atgagacact cgatcatccg ctccctggca gtcggcgccg tcgcggcgct cgcgctcgga        60
     gcgtgcagct ccggcaccgg cggatcagcc aaggggcgca agccgtacat cggcgtgatc       120
     ctgcccgaca ccacgtcctc cgcccgctgg gcgacgcagg accagccggc tctggccgcg       180
     gcgttcaaag ccaagaacgt caagtacgac atccagaacg cgcagggcaa caagacccag       240
     ttccaggcga tcgccgacca catgctcaag gagggcgtca acatcctgat gatcgtcgac       300
     ctggacgccg ccacgggcac cgcggtgctg gccaaggcgc ggcagcaggg cgtgccgacc       360
     atcgactacg accgcctcac cctgggcggc ggcgcggact actacgtcag cttcgacaac       420
     gtggacgtcg gcgagctcca ggggcagggt ctggtggcgt gcctgggcgg caccaagaag       480
     ccggtcgtgg ccgaggtgaa cggctccccc acggacaaca acgcgacgct gttcgcacag       540
     ggctacaact ccgtgctcaa cccgctctac gccgacggca cgttcatcaa gggcccgaac       600
     cagtccacca ccgactggaa gaacgacatc gccggccaga acttcgcgaa gatgctcgcc       660
     gaggcgccga acatcggcgg cgtgctggtg gccaacgacg gcatggccca ggcggtgatc       720
     ggcgtcctga agcagcacca cctcaacggc agggtccagg tcaccggtca ggacgcgacc       780
     gtcgccgggc tgcagtcggt gctggtcggc gaccagtgca tgaccatctt caaggactcg       840
     gtgaaggagg cgaacgccgc cgccgagctg gcgaccgccc tggccaccgg cggttcggcg       900
     agttcggcca acacgatggt cgccgacagc gtcaccggca agctcgtcgc gtccgtgatg       960
     ctgacgccgg aggccatcgt caagcagaac gtgggcgacg tcatctccgc cggcgcggtc      1020
     acgaaggccc aggtgtgcac cccggaattc gccgaggcct gcacggcgaa cggcatcaag      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page