(data stored in ACNUC7421 zone)

EMBL: CP001700.PE445

CP001700.PE445       Location/Qualifiers
FT   CDS_pept        complement(505599..506447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0448"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: nca:Noca_0921 ABC transporter related;
FT                   TIGRFAM: phosphate ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69400"
FT                   /db_xref="GOA:C7PX49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX49"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACU69400.1"
FT                   /translation="MTDSDLSHAGAVAVDDRPDAAGPHLPGTLEARAVSAWFGDRKVLD
FT                   RVSLTMPGGQVTALIGPSGCGKSTFLRILNRMHELVASAALAGEVLLDGGDIYDPRVRL
FT                   TEARARIGMVFQKPNPFPGMSIYDNVTAGLKLTGTRRSRSEQDDIVESCLTRAGLWNEV
FT                   SDRLKQPGGALSGGQQQRLCIARSLAVRPEVLLMDEPCSALDPTSTNRIEETIRELASD
FT                   VTIVIVTHNMQQASRVSDRCAFFLASAGTPGRIVEHGQTRAMFSSPQDQRTSDYVNGRF
FT                   G"
     atgactgaca gcgatctgag ccacgccggt gcggtggctg ttgacgaccg ccccgacgcc        60
     gccggtccgc acctgcccgg caccctggaa gcccgcgccg tctcggcctg gttcggcgac       120
     cggaaggtcc tcgaccgcgt ctcgctgacc atgcccggcg gccaggtcac ggcactgatc       180
     gggccctcgg gctgcggcaa gtcgacgttc ctgcgcatcc tgaaccggat gcacgagctc       240
     gtcgcgtcgg cggcgctggc cggcgaggtc ctgctggacg gcggcgacat ctacgacccg       300
     cgggtccgtc tcaccgaggc cagggcgcgg atcggcatgg tcttccagaa gccgaatccc       360
     ttccccggca tgtcgatcta cgacaacgtc accgccggct tgaagctcac cgggacccgc       420
     cgcagccggt cggagcagga cgacatcgtc gagtcctgcc tcacgcgcgc gggtctgtgg       480
     aacgaggtgt ccgaccgcct caagcagccc ggcggcgcgc tctcgggcgg tcagcagcag       540
     cggctgtgca tcgcgcgttc gctcgcggtg cgcccggaag tgctgctgat ggacgagccg       600
     tgctcggccc tggacccgac atcgaccaac cggatcgagg agaccatccg cgaactcgcc       660
     tccgacgtca cgatcgtcat cgtgacccac aacatgcagc aggcgtcccg cgtctccgac       720
     cgctgcgcct tcttcctggc ttcggcgggc actccgggac gcatcgtgga gcacgggcag       780
     acgagggcga tgttcagctc gccgcaggac cagcggacgt cggactacgt caacggacga       840
     ttcggctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page