(data stored in ACNUC7421 zone)

EMBL: CP001700.PE446

CP001700.PE446       Location/Qualifiers
FT   CDS_pept        complement(506478..507128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0449"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: nca:Noca_0919 peptidase C60, sortase
FT                   A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69401"
FT                   /db_xref="GOA:C7PX50"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX50"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU69401.1"
FT                   /translation="MLRAGVPVAVLAIPSVGVDEVVGEGTGAAVLESGPGLRRDTVLPG
FT                   QAGTSVIMARASGYGGPFRYLDQLQPGDRVEVTTGQGVADYRVSDVRRRGDPEPARLHG
FT                   QLGRLTLVTASGAAYTPNGALYVDADLISDVQPTPPAPVPHPGAEESAMGEDRYARPDV
FT                   AAWTAVLAGATVLAFWAGPRWGRAKTWLVAVPVLLVVGLTLADRIALLLPNLT"
     atgttgcggg cgggggtgcc ggtggcggtc ttggcgattc cgagtgtcgg ggttgatgag        60
     gttgtcgggg aggggactgg tgcggcggtt ttggagtccg ggccgggttt gcggcgggac       120
     accgtcttgc cggggcaggc ggggacgagt gtgatcatgg cgcgtgcctc ggggtacggc       180
     ggtccgttcc ggtatctcga ccagttgcag cctggggatc gcgtcgaggt gacgaccggt       240
     cagggggtgg cggactaccg cgtctcggat gtccggcggc gcggcgaccc ggaacctgcg       300
     cggctgcatg gccagttggg ccgcctgact ctggtcaccg cgtccggtgc cgcgtatacg       360
     ccgaatggtg cgttgtacgt cgatgccgac ctgatctcgg acgttcagcc gaccccgccg       420
     gctccggttc cgcatcccgg cgctgaggag tccgcgatgg gcgaggaccg gtacgcgcgg       480
     cctgatgtcg ccgcctggac cgcggtgttg gcgggcgcga cggttttggc gttctgggcc       540
     gggccgcggt gggggcgggc caagacgtgg ctggtcgctg tgccggtgct gcttgtcgtg       600
     gggctgacgc tcgcggaccg gatcgccctg ctgttgccga atctgacctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page