(data stored in ACNUC7421 zone)

EMBL: CP001700.PE447

CP001700.PE447       Location/Qualifiers
FT   CDS_pept        complement(507808..508311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69402"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69402.1"
FT                   /translation="MSGTTDSPARVAALTVIIVTAWLHAGSSAMADTGATSGPALGGGD
FT                   ITVSTLMAPGSLVISVPLRQPALTSKLQPITVTDNRTEDPGWTVTVILTSHETAGLTWN
FT                   PDLLSAAPGESVILGPKTGPRPSLQQPRTLASTQPGASLGTALLSAALYPSGSGAATFT
FT                   LTAI"
     atgagcggga cgactgattc gcccgcgcgc gtagcggcgc tgacggtgat catcgtgacg        60
     gcgtggctgc acgctggttc ctcggccatg gctgacaccg gcgcgacatc cggcccagca       120
     ctcggcggcg gcgacatcac cgtgtcgacg ctgatggcgc ccggctccct ggtgatcagc       180
     gtgccactcc gacaaccggc actgaccagc aagctccaac cgatcaccgt gacggacaac       240
     cgcaccgagg acccaggctg gaccgtgacg gtaatcctca ccagccacga aaccgccggc       300
     ctgacctgga accccgacct gctctcggcg gcgcccggcg aatcggtaat cctgggcccg       360
     aaaaccggac cgcgaccaag cctgcaacag ccgcgcaccc tggcctcaac gcagcccggc       420
     gcaagcctcg gaacagcgct cctgagcgca gcgctgtacc cgagcggaag cggcgccgcg       480
     accttcaccc tcaccgcgat ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page