(data stored in ACNUC7421 zone)

EMBL: CP001700.PE448

CP001700.PE448       Location/Qualifiers
FT   CDS_pept        complement(508308..509465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0451"
FT                   /product="protein of unknown function DUF916 cell surface
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF916 cell
FT                   surface putative; KEGG: saq:Sare_2622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69403"
FT                   /db_xref="GOA:C7PX52"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX52"
FT                   /inference="protein motif:PFAM:PF06030"
FT                   /protein_id="ACU69403.1"
FT                   /translation="MPRLRSLIKVLAATAVAGVLLTSPASAGTPPRTDPAPAPAPTAGA
FT                   ATFGIQPATATARDKTRDSFTYQATPGAKKTDYVAVSNYSTSPLTLRIYATDAYNTADG
FT                   GFTVLPLATKPRDVGLWVSFPTTGVTLAAKSSKILPFTLTVPADAKPGDHVGGIMLSLT
FT                   TQAADAKGGQIAVESRVGTRLQVRVPGTLKAQLTVSHISTSYHASSNPFGGGTMTVSYT
FT                   VANTGNVRLSGTQKVHVTSLFGGSKPSLPLANVKELLPGDQERVTATVKSVLPSFSSTA
FT                   HISVVPTPVVGDIDPVLAAVDESASVATIPWPMILLLLALGAFGGVWVWRRRVRVRVRK
FT                   QQAAKAKAKAAKTAPAKKTAVPATAAATATAGAASKAESGKAEDV"
     atgccccgtc tccgttccct gatcaaggtg ctggctgcca cggccgtggc cggtgtgctc        60
     ctgacgagcc cggcgtcggc cgggaccccg ccgaggaccg atccggcgcc cgcgcccgcg       120
     ccgaccgccg gcgcggcgac cttcggcatc cagccggcca ccgccaccgc gcgcgacaag       180
     acccgcgact ccttcaccta ccaggcgacg ccgggcgcga agaagaccga ctacgtcgcg       240
     gtctccaact acagcaccag cccgctgacc ctgcgcatct acgcgaccga cgcctataac       300
     accgcggacg gcggcttcac ggtcctgcca ctggcgacca agccgcgcga cgtcggcctg       360
     tgggtgtcct tccccaccac cggcgtcacc ctggccgcca agtcctcgaa gatcctgccc       420
     ttcacgctga ccgtccccgc cgacgccaag cccggcgacc acgtcggcgg catcatgctg       480
     tcgctgacga cgcaggccgc ggacgccaag ggcggccaga tcgcggtcga gtcccgcgtc       540
     gggacgcggc tgcaggtgcg cgtccccgga acgctgaagg cacagctgac cgtgagccac       600
     atatcaacgt cctaccacgc ctcctcgaac ccgttcggcg gcggcacgat gaccgtgtcc       660
     tacaccgtcg cgaacaccgg gaacgtccgg ctgtcgggaa cacagaaggt gcacgtcacc       720
     agcctgttcg gcggctccaa gcccagcctg cccctcgcca acgtcaagga actgctgccc       780
     ggcgaccagg agcgggtgac ggcgacggtg aagtcggtgc tgccgtcctt cagctccacg       840
     gcgcacatct cggtcgtgcc gacaccggtc gtcggggaca tcgatccggt gctggcagcc       900
     gtggacgaga gcgcgtcggt ggcgacgatc ccgtggccca tgatcctgct gctcctggcg       960
     ctcggcgctt tcggcggcgt gtgggtgtgg cggcggcggg tgcgggtgcg ggtgcgtaag      1020
     cagcaggccg cgaaggcgaa agcgaaagcc gcgaagactg ctccggcgaa gaagaccgcg      1080
     gtgcctgcca ctgccgccgc cactgccact gccggcgccg cgtcgaaggc ggaaagcgga      1140
     aaggcagagg acgtatga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page