(data stored in ACNUC7421 zone)

EMBL: CP001700.PE449

CP001700.PE449       Location/Qualifiers
FT   CDS_pept        complement(509613..511190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0452"
FT                   /product="NHL repeat-containing protein"
FT                   /note="KEGG: sus:Acid_6846 NHL repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69404"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX53"
FT                   /inference="similar to AA sequence:KEGG:Acid_6846"
FT                   /protein_id="ACU69404.1"
FT                   /translation="MFSNRFARYAATAVAAATAVGVMTVLSAATASAAASGTITFSPGS
FT                   GADTSVFNVETSGVCPANDTYIDATISGGGFPANAVAINKEPVSVLTATQTGYEIAISN
FT                   NLRQLATNYAVTKLDPNASGQTPYTIDVQCIPALGNTVGADFAGQLTFTSETAWSSASS
FT                   TPTTTTLGLAPTSPVSFGSQVTLTATVNPAAAGSVTFFDGATALNATPVAVANGTASYQ
FT                   TSSLAVGAHTITAAFTSTDANFANSTSAASTYTVGQAGPVATTTSLVSTPGSAQVAGGN
FT                   VDLTASVQPATAAGSVTFMDGATSLGTVAVSNGSAVFNTTALALGSHSLTASFVPTNTT
FT                   AYGSSASPAVPFTVTKYVPPTATETITTTVDAGSLNISVPTGQVSLPDPALNSNGTLFT
FT                   TSGSLETVTVTDNRAGNPGWTASGLATAFAQTGGSVQISAENLGWTPGTPTGSAGQTLT
FT                   TGPSVAPANGVAASDNGALGLSQSRTLVSAASGAGLGTAKIGATLALNVPTTTTAGTYQ
FT                   STLTLTVI"
     ttgttcagca acaggttcgc ccgctacgcg gcgaccgcgg ttgccgccgc cacggcggtc        60
     ggtgtgatga cggtgctcag cgccgccacc gcgtcggcgg ccgcctccgg caccatcacg       120
     ttctcgccgg gctccggcgc ggacacctcg gtgttcaacg tcgagacctc gggcgtgtgc       180
     ccggcgaacg acacctacat cgacgccacc atctccggcg gcggcttccc ggccaacgcc       240
     gtcgccatca acaaggagcc ggtctccgtg ctcacggcga cgcagaccgg ctacgagatc       300
     gccatctcca acaacctgcg gcagctggcg accaactacg cggtcaccaa gctggacccg       360
     aacgcctcgg gtcagacccc gtacacgatc gacgtccagt gcatcccggc gctgggcaac       420
     accgtgggcg cggacttcgc cggccagctg acgttcacca gcgagaccgc gtggagctcg       480
     gcgtccagca cgccgaccac caccacgctg ggtctggcgc cgaccagccc ggtgtccttc       540
     ggttcccagg tcacgctgac cgcgacggtc aacccggccg ctgccggctc ggtcacgttc       600
     ttcgacggcg cgaccgcgct caacgccacc ccggtcgcgg tggccaacgg cacggcgagc       660
     taccagacca gctcgctggc ggtcggggcg cacacgatca ccgccgcgtt cacttccacc       720
     gacgcgaact tcgccaactc gacctcggcg gcgtctacct acaccgtcgg ccaggccggt       780
     ccggtggcca ccaccacctc gctggtgagc accccgggtt cggcgcaggt ggccggcggc       840
     aacgtcgacc tgaccgcgag cgtgcagccg gcgaccgccg ccggttcggt cacgttcatg       900
     gacggcgcga cgtctctggg cacggtcgcg gtgagcaacg gctccgcggt gttcaacacg       960
     accgccctgg cgctgggctc gcacagcctc acggcgtcgt tcgttcccac caacacgacc      1020
     gcgtacggtt cctccgcctc gccggcggtc ccgttcacgg tcaccaagta cgtcccgccg      1080
     accgcgacgg agaccatcac caccacggtc gacgccggct cgctgaacat cagcgtgccg      1140
     accggccagg tctccctgcc ggacccggcg ctgaacagca acggcaccct gttcaccacc      1200
     tccggctcgc tggagacggt gaccgtcacc gacaaccgcg cgggcaaccc cggctggacc      1260
     gcctcgggcc tggccacggc gttcgcgcag accggcggca gcgtccagat cagcgcggag      1320
     aacctggggt ggacccccgg cacgccgacc ggctcggcgg ggcagaccct gaccaccggc      1380
     ccgtccgtcg ccccggcgaa cggtgtcgcg gcctccgaca acggcgcgct gggcctgtcg      1440
     cagtcccgga ccctggtctc cgccgcctcc ggcgcgggcc tgggcaccgc caagatcggc      1500
     gcgacgctgg cgctgaacgt cccgaccacg accacggccg gtacgtatca gagcacgctc      1560
     acgctgaccg tcatctga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page