(data stored in ACNUC7421 zone)

EMBL: CP001700.PE45

CP001700.PE45        Location/Qualifiers
FT   CDS_pept        complement(46660..47241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0045"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: krh:KRH_00110 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69000"
FT                   /db_xref="GOA:C7QFR1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR1"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU69000.1"
FT                   /translation="MTETERQQTVAENLYATIKTNHGDIVVRLLPDYAPKTVANFVGLA
FT                   EGTREWTHPETNVTSTTPLYDGTIFHRIIPQFMIQGGDPLGQGFGGPGYVFDDEPHPDQ
FT                   TFNDRDYLLAMANAGIRNGKGTNGSQFFITVPTPRRPTHLNGKHTIFGEVVDADSRKVV
FT                   DEIAGVRTGAQDRPVNDVVIEKISIERREG"
     atgacagaaa ccgaaaggca acagactgtg gccgagaacc tgtacgccac catcaagacg        60
     aaccacggcg acatcgtggt gcggctgctt ccggactacg ctccgaagac cgtcgccaac       120
     ttcgtgggtc tggcggaggg gacccgggag tggacgcacc cggagaccaa cgtgacgtca       180
     accacgccgc tgtacgacgg cacgatcttc caccggatca tcccgcagtt catgatccag       240
     ggcggcgacc cgctgggcca gggcttcggc ggcccgggct acgtcttcga cgacgagccg       300
     caccccgacc agaccttcaa cgaccgcgac tacctgctgg ccatggccaa cgccgggatc       360
     cgcaacggca agggcaccaa cggctcgcag ttcttcatca ccgtcccgac cccgcgccgg       420
     ccgacccacc tcaacggcaa gcacacgatc ttcggcgagg tcgtggacgc cgacagccgc       480
     aaggtcgtgg acgagatcgc gggagtgcgg accggtgcgc aggaccggcc ggtgaacgac       540
     gtcgtgatcg agaagatctc catcgagcgc cgcgagggct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page