(data stored in ACNUC7421 zone)

EMBL: CP001700.PE450

CP001700.PE450       Location/Qualifiers
FT   CDS_pept        complement(511249..512247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0920 ABC-type phosphate transport
FT                   system periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69405"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69405.1"
FT                   /translation="MNQKTKKLAVIGAVGLFVLGAAGSAQADPSGAPQFRQLAGVGSDT
FT                   TTPVMNALSNDLTVGGTKVIGSYDATGSTTIATQAGTTCSKIARPNGSGAGRTALLASL
FT                   AAKDGCLQFSRSSSLTLTATGGAQLTYVPFALDGVTYAITGTDTLIPRNLDLATLQSIY
FT                   TCDPTVVGTAPNFSITAMLPQAGSGTRSFWEGKMGITDADVVAGKYACITDKSNGQPIE
FT                   EQDGRVLTDKAIIPYSIASYDAEESQTIQDVRGAAVLGAVGGVAAQQINSSFPVTREVY
FT                   NVIPTADTATAPWSTTFVGSSSLVCADSSTITKFGFTVAPDCGSTTNVTAP"
     gtgaaccaga agacgaagaa gctcgccgtc atcggcgcgg tcgggctgtt cgtgctgggc        60
     gcggccggtt cggcgcaggc cgacccgagc ggcgccccgc agttccggca gctggccggc       120
     gtcggctcgg acaccaccac cccggtgatg aacgcgctgt cgaacgacct caccgtcggc       180
     ggcaccaagg tcatcggctc ctacgacgcc accggctcga cgacgatcgc cacccaggcc       240
     ggcacgacct gctcgaagat cgcccgcccg aacggctccg gcgccggccg caccgcgctg       300
     ctggcctcgc tggccgccaa ggacggctgc ctgcagttct cccgctcctc cagcctgacc       360
     ctgaccgcca ccggcggcgc gcagctgacc tacgtgccgt tcgcgctgga cggcgtgacc       420
     tacgccatca ccggcaccga cacgctgatc ccgcgcaacc tggacctggc cacgctgcag       480
     tccatctaca cctgcgaccc gaccgtggtg ggcaccgccc cgaacttctc catcaccgcg       540
     atgctgccgc aggccggatc gggcacccgc tcgttctggg agggcaagat gggcatcacc       600
     gacgcggacg tggtcgccgg caagtacgcc tgcatcaccg acaagtccaa cggccagccc       660
     atcgaggagc aggacggccg cgtcctgacc gacaaggcga tcatccccta ctccatcgcg       720
     tcgtacgacg ccgaggagtc gcagaccatc caggacgtcc gcggtgccgc ggtcctgggc       780
     gccgtcggcg gggtcgccgc gcagcagatc aactccagct tcccggtcac gcgcgaggtc       840
     tacaacgtga tcccgaccgc ggacaccgcg accgcgccgt ggagcaccac gttcgtcggc       900
     tcgtcctcgc tggtctgcgc cgactcctcg acgatcacga agttcggctt caccgtcgcc       960
     cccgactgcg ggagcaccac caacgtcacc gctccgtag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page