(data stored in ACNUC7421 zone)

EMBL: CP001700.PE451

CP001700.PE451       Location/Qualifiers
FT   CDS_pept        complement(512244..515093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69406"
FT                   /db_xref="GOA:C7PX55"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69406.1"
FT                   /translation="MRTLTISRVVSGAFAVCVAVSGLLSGPTSHAAAAAAPQPTPKTNA
FT                   TQTASSPLTKTGTGAFSGMAVTVDKSQDLINEAIGISWTGAPTTLPRNNNTNFGADYLQ
FT                   IMQCWGDNPAGPDASQCEFGGTTLGGPTTRRLNNPQIPDPLLPPAVANDPNQEYEDFVP
FT                   APTAAPTSPYAPPAPVKDPSQIATSFDSSNTNEIPYARTYANGTGHVYFQLDTVRESPA
FT                   LGCGQPVADPAAPGGARIEPCWLVVVPRGTLEADGKTTVDGTNIVLQTSPLSPTNWANR
FT                   IVFPLTFQPAASACAIGANEVQIGGDEMLAEAIKSWEPGLCAHNPKAPFSFSQIGGDAA
FT                   RLQLASPSPGFQFLSKPVTSTPGTPLPSMLYAPAAISGLTISFYIQSQAVVPPPGQPPN
FT                   PPAAQNGVQLTQLNLNARLVAKLVTQSYRWGVDSSIDTPQGAASDLAKQNPRDLTQDPE
FT                   FLTLNPQFKGLSFAGGIPSIVVPFGNADAYTELWTWLKSDPAASEFLSGVADNTGKYGQ
FT                   PGYSGMVLNPNYLRTQFPIEDFPTTDPYCRPTVYQDPSHAGTRNQQSALCGLALHPYPV
FT                   TMHDGVLNATKGSLGLRVSWSPNSANVGSWGPTPPQPDGQVAILVLADAPTAARYGLPA
FT                   ARLCDDRAGVPDPLLPPGQQPSADLDAHCVAPTTDSLLKGVAAAQPSPGAPTMLVPNPI
FT                   PIDLGAYPLTTLTYAATAPSKLTKADGAHYADLLDYIASAGQIQGLDPGDLPPGYAPLP
FT                   AALAAQTAAAAKLLRTAAGVPEAAPIGSAPSSSATSRPAAIVTPHAPSTPPPPRVPVQH
FT                   PPLPKPTGPGPAVVVRGTMPASDLALSAGSTPAVPIGRIRFAVLICLLAAGASVLVGPG
FT                   LLRVARQAAAEGAVDGEPDSSGESDEPGEPDEPDSPGEPADSPEPADPEALDAPDVPAP
FT                   ESPETNPSQDPSPSKGTGQ"
     atgaggaccc tgacgatctc gcgtgtcgtc tccggggcgt tcgccgtctg cgtggcggtc        60
     tccggactgc tctccggtcc gacgtcgcat gccgctgccg ctgccgcacc acagccgacc       120
     ccgaaaacga acgcgacgca gaccgcgagc tcaccgctca ccaagaccgg taccggcgcc       180
     ttcagcggta tggcggtcac cgtcgacaag tcgcaggacc tgatcaacga ggccatcggc       240
     atcagctgga ccggcgcgcc gacgaccctc ccgcgcaaca acaacacgaa cttcggcgcc       300
     gactacctcc agatcatgca gtgctggggc gacaacccgg cgggtccgga cgcctcgcag       360
     tgcgagttcg gcggtacgac gctgggcggc ccgaccacga ggcggctgaa caatccccag       420
     attccggacc cgttgctgcc tccggccgtc gccaacgacc ccaaccagga gtacgaggac       480
     ttcgtcccgg ctccgaccgc cgcgccgacg tccccttacg cgccgccagc gccggtgaag       540
     gacccctcgc agatcgccac gtccttcgac agctcgaaca cgaacgagat cccctacgcc       600
     cggacctatg ccaacggcac cggccacgtc tacttccagc tggacaccgt ccgcgagtcc       660
     ccggcgctgg gctgcggaca gccggtcgcc gatccggcgg cgcccggcgg cgcccggatc       720
     gagccgtgct ggctggtcgt ggtcccgcgc ggcacgctgg aggcggacgg caagaccacc       780
     gtcgacggca ccaacatcgt cctgcagacc tcgccgctgt ccccgacgaa ctgggcgaac       840
     cggatcgtct tcccgctgac cttccagccg gcggcctccg cctgcgcgat cggcgcgaac       900
     gaggtgcaga tcgggggcga tgagatgctc gccgaggcga tcaagagctg ggagccgggg       960
     ttgtgcgccc acaatcccaa ggctccgttc agtttctcgc agatcggcgg ggacgccgcg      1020
     cgcctgcagc tcgcctcgcc gagtcccggg ttccagttcc tgtccaaacc ggtcacctcg      1080
     acgccgggca cgccgctgcc gtcgatgctc tacgcgccgg ctgcgatctc cgggctgacg      1140
     atctcgttct acatccagag ccaagcggtc gtcccgccgc cggggcagcc gccgaacccg      1200
     cctgccgcgc agaacggcgt gcagctcacc cagctcaatc tgaacgccag gctggtcgcg      1260
     aagctcgtca cgcagtccta ccgatggggt gtcgactcct ccatcgacac gccacaaggc      1320
     gcggcatcgg acctggcgaa gcagaatccc cgcgacctga cgcaagaccc tgagttcttg      1380
     accctgaacc cgcaattcaa gggtctgagt ttcgccggcg gcatcccttc catcgtggtc      1440
     ccgttcggca acgccgacgc ctacaccgag ctgtggacct ggctcaagag cgatccggcg      1500
     gcatcggaat tcctgagcgg agtcgcggac aacaccggta agtacggtca gcccggttac      1560
     tcgggcatgg tcctcaaccc gaactacctc cggacgcagt tcccgatcga ggacttcccg      1620
     acgaccgacc cctactgccg tcccacggtg tatcaggacc cttcgcacgc cgggacgcgc      1680
     aaccagcaga gcgccctgtg cggtctggcg ctgcatccgt atccggtcac catgcacgac      1740
     ggggttctca acgccaccaa gggaagcctg ggcctgcgcg tctcgtggag cccgaacagc      1800
     gcgaacgtgg gttcctgggg tccgacaccg ccgcagccgg acgggcaggt cgccatcctg      1860
     gtgctcgccg acgccccgac cgccgcgcgc tacgggctgc cggccgcccg gctgtgcgac      1920
     gaccgcgccg gggtgcccga tccgttgctg ccgcccgggc agcagccttc ggcggatctc      1980
     gacgcgcact gcgtcgcgcc aaccaccgac tcgctgctga agggggtcgc ggcggcgcag      2040
     cccagtccgg gggcgccgac gatgctggtc ccgaatccga tcccgatcga cctcggcgcg      2100
     tatccgttga ccacgctcac ctatgccgcg accgcgccga gcaagctgac gaaggccgac      2160
     ggcgcgcact acgccgatct gctggactac atcgcgagcg ccgggcagat ccagggactg      2220
     gaccccggcg accttccgcc cggctacgca ccgctgcccg ccgccctggc cgcgcagaca      2280
     gccgcggcgg cgaagctgct gcggaccgcc gccggagtgc cggaggccgc gccgatcggg      2340
     agcgcgccgt ccagcagcgc cacgagccgt ccggccgcga tcgtcacgcc gcatgcgccc      2400
     tcgactccgc cgccgccgcg cgtgccggtg cagcatccgc cgcttccgaa acccaccggt      2460
     ccgggtccgg cggtcgtggt gcgaggcacc atgccggcca gtgatctggc gctgtcggcc      2520
     gggagcacgc cggccgtgcc gatcggcagg atccgcttcg ccgtgctgat ctgcctgctg      2580
     gcggcggggg cgagcgtcct ggtcggtccc gggctgttgc gggtggcgcg ccaggcggcg      2640
     gctgagggcg cggtggacgg cgagcccgac tcatccggcg agtctgacga acccggcgag      2700
     cccgacgagc ccgactcacc cggcgaaccc gccgactccc ccgagcccgc ggatcccgaa      2760
     gccctggacg cccctgacgt cccggcaccc gagagtcctg agacgaaccc gtcccaggat      2820
     ccgtccccct cgaagggaac aggacagtga                                       2850
//

If you have problems or comments...

PBIL Back to PBIL home page