(data stored in ACNUC7421 zone)

EMBL: CP001700.PE452

CP001700.PE452       Location/Qualifiers
FT   CDS_pept        complement(515090..516802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0455"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="KEGG: nca:Noca_0917 phosphate ABC transporter,
FT                   periplasmic phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69407"
FT                   /db_xref="GOA:C7PX56"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX56"
FT                   /inference="similar to AA sequence:KEGG:Noca_0917"
FT                   /protein_id="ACU69407.1"
FT                   /translation="MNRHHPRRRRSPRGRLLLLSAALGLSAAQLLSPPTAGATQYAPIA
FT                   GAGSTWAENAVNQWTSDVAQYGMQVSYTGSGSSDGRNQFKADPATVDFAISDIPYGSVD
FT                   NGTLDTLPDKPFAYMPVVAGGTAFMYHLDIGGHRVTNLRLDDQTIAKIFTGGITTWNDP
FT                   AIAKTNPGLTLPARQIIPVVRTDGSGTTAQLTGWMAAKYPGLWDSFCSAAGRVVSPHCG
FT                   STSFFPPAPAGSAFISQSLDSGVAGYVAQPTSEGAITYTEYSYALQSGFPVAKMLNAAG
FT                   YYTLPTASNVAVSLTQAQIDNDASDPTKYLTENLANVYGYSDPRTYPLSSYSYMIVPLS
FT                   TAPPFNTAKGVTLSAFDYYLLCQGQSTMAPLGYSPLPINLVQAGFNQIRKIPGAVVQNI
FT                   VISSCNNPTFSSSGVNTLVASAPDPPSCDKNGATQCAADGVTAVPGGGSSGGSHGGSSG
FT                   GGSGGSGGSSGGSGGGGGTSGGGTAGGVASGPSNGNPSAHPSSTSNVITVPTTPSSPPV
FT                   SLDGADAVAVPVSVGTSLGDSVGAYLAAAAATLLLTTVFGPPLVSRLRKGRRS"
     atgaaccgcc accacccgcg gcgccgtcga tcgccgcgcg gcaggctcct gctgctctcc        60
     gccgccctcg gcttgtccgc cgcacaactc ctgagcccgc cgaccgccgg ggcgacgcag       120
     tacgcgccga tcgccggcgc cggatcgacc tgggccgaga acgccgtcaa ccagtggacc       180
     agcgacgtcg cgcagtacgg catgcaggtc agctacaccg gctccggctc ctccgacggc       240
     cgcaaccagt tcaaggcgga cccggcgacg gtcgacttcg cgatctccga catcccctac       300
     ggctcggtcg acaacgggac cctggacacg ttgccggaca agccgttcgc gtacatgccg       360
     gtggtggccg gcggcacggc gttcatgtac cacctggaca tcggcggcca ccgcgtgacg       420
     aacctgcgcc tggacgacca gacgatcgcg aagatcttca ccggcggcat cacgacctgg       480
     aacgatccgg cgatcgcgaa gaccaacccc ggtctgacgc tgccggcccg gcagatcatc       540
     ccggtcgtgc gcaccgacgg ctccggcacc accgcgcagc tgaccggctg gatggccgcc       600
     aagtatcccg ggctgtggga ctcgttctgc tcggcggcgg gccgcgtggt ctccccgcac       660
     tgcggctcga cctcgttctt cccgccggcg cccgccggat cggcgttcat ctcgcagtcg       720
     ctggactccg gggtcgcagg ctacgtcgcg cagcccacct cggagggcgc gatcacgtac       780
     accgagtact cctacgcgct ccagtccgga ttcccggtcg cgaagatgct caacgccgcc       840
     ggctactaca cgctgccgac cgcctcgaac gtcgcggtgt ccctgacgca ggcacagatc       900
     gacaacgacg cctcggatcc cacgaagtac ctcaccgaga acctggcaaa cgtctacggg       960
     tactcagatc cgcggaccta cccgctgtcc agctacagct acatgatcgt gccgctgtcc      1020
     accgccccgc cgttcaacac cgccaagggt gtgacgctca gcgccttcga ctactacctg      1080
     ctgtgtcagg gccagagcac gatggcgccg ctgggttact cgccgctgcc gatcaacctg      1140
     gtgcaggcgg ggttcaacca gatccggaag atccccgggg cggtcgtgca gaacatcgtg      1200
     atctcctcct gcaacaaccc cacgttctcc tcgagcgggg tcaacactct ggtggcgagc      1260
     gccccggacc cgccgtcgtg tgacaagaac ggcgccacgc agtgcgccgc cgacggcgtg      1320
     accgcggtcc cgggaggcgg ctcgtcgggc ggatcccacg gtggctcctc cgggggcggt      1380
     tccggcggat ccggtggctc cagcggagga tccggcggcg gtggcggaac ctcaggcggt      1440
     gggacggccg gtggcgtcgc aagcggaccc agcaacggca atccatcggc gcatccgagc      1500
     tcgaccagca acgtcatcac cgtgccgacg accccgagct ctcccccggt ctcgctcgac      1560
     ggcgccgacg ccgtcgcggt cccggtctct gtcggcacgt cgctcggcga ctcggtcggc      1620
     gcctacctcg cagcggctgc ggcgactctg ctgctgacga ccgtgttcgg tccgcctctg      1680
     gtgtcccgcc tacggaaggg gcgccgatca tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page