(data stored in ACNUC7421 zone)

EMBL: CP001700.PE453

CP001700.PE453       Location/Qualifiers
FT   CDS_pept        complement(516799..518133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0456"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: nca:Noca_0916
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69408"
FT                   /db_xref="GOA:C7PX57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX57"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACU69408.1"
FT                   /translation="MTATDMAAADIAAADMTGLTEEPEDAGTTVPPEPAADDAGPPERR
FT                   RRVRRLKRDALFALLGAAAAAVSLTILISTWFAPFSGPLGFVVLSYPLFLACYAVLVWT
FT                   DESGPILRDRLMAVVTHSIAILVAGVLVLIVGFPIWGGLKSLTHLNFYTQDLRVAGPVQ
FT                   PITIGGLQHAVIGTAEQITITLAITVPLGIACAVFMNESPGRLANLVRTVAAAATALPS
FT                   IVAGLFVFALLILELGLPKSGLAAALALSVMTLPIIIRASDVVLRLVPGHLKEASYALG
FT                   ASRWRTALRVTLPTARSGLATAVILGAARGIGETSPVLLTAGYTQYTNYDPRKGPQTSL
FT                   PLATFKLVTSGQPNYVTRGYGAAALLMLLVLVLFVAARAVGGRGAGQLSRRQRRRRAAT
FT                   SRRVQERFLARRAAREQADPATAAAASATPAATTADRPEPMEHSS"
     atgacggcca cggacatggc agccgcggac atcgcggcag ccgacatgac cggcctcacc        60
     gaggaaccgg aagacgccgg aacgaccgtc cccccggaac cggcagcgga cgacgccggc       120
     ccaccggaac gacgccgccg cgtccgacgc ctgaaacgcg acgcgctgtt cgcgctcctc       180
     ggcgcggcgg cggcagcggt gagcctgacc atcctgatca gcacctggtt cgcgccgttc       240
     tccggaccgc tgggcttcgt cgtcctgagc tatcccctct tcctcgcctg ctacgcggtc       300
     ctggtctgga cggacgaaag cggcccgatc ctgcgcgacc ggttgatggc ggtggtgacg       360
     cactcgatcg ccatcctggt cgccggagtg ctcgtgctga tcgtcggctt cccgatctgg       420
     ggcggcctga agtccttgac ccacctcaac ttctacacgc aggacctgcg cgtcgccggt       480
     cccgtgcagc cgatcacgat cggcggtctc cagcacgccg tgatcggcac cgccgagcag       540
     atcaccatca cgctggccat cacggtcccg ctcggcatcg cctgcgcggt gttcatgaac       600
     gagtcccccg gacggctggc gaacctggtg cgcaccgtcg cggcggcggc caccgcgctg       660
     ccctcgatcg tcgccgggct gttcgtcttc gccctgctca tcctcgaact cgggctcccg       720
     aagtcagggc tggccgccgc gctcgcgctg agcgtgatga cgctgccgat catcatccgc       780
     gcctccgatg tcgtgctccg tctggtgccc ggccatctga aggaggcctc ttacgccctg       840
     ggagccagcc gttggcggac cgcgctgcgc gtcaccctgc cgacggcacg gtcgggactg       900
     gccacggcgg tgatcctggg ggcggcgcgc ggcatcggcg agacctcgcc ggtgctgctc       960
     accgcgggct acacgcagta cacgaactac gacccgcgca agggtccgca gacctcgctg      1020
     ccgctggcga cgttcaagct cgtcacttcc ggccagccga actacgtcac gcgcggatac      1080
     ggcgcggcgg cgctgctgat gctgctcgtg ctcgtgctgt tcgtcgccgc gcgggcggtc      1140
     gggggcaggg gcgcggggca gctcagccgg cggcagcggc ggcgccgggc cgcgacgtcg      1200
     aggcgggttc aggaacgctt tttggcgcgc cgcgccgccc gcgagcaggc cgatcccgcg      1260
     acggccgcgg ccgcatccgc gacacccgcc gccacgacgg ccgaccgccc cgaaccgatg      1320
     gagcactcgt catga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page