(data stored in ACNUC7421 zone)

EMBL: CP001700.PE454

CP001700.PE454       Location/Qualifiers
FT   CDS_pept        complement(518135..519256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0457"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: nca:Noca_0915
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69409"
FT                   /db_xref="GOA:C7PX58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX58"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACU69409.1"
FT                   /translation="MTEQFIPPAGHAQAASAAAGAAGATTAAAANALTHVVDLPPTAGA
FT                   EPPRAVRLKARGGDRVFLTVLAGSGILVLTVIAVIGGFLGSRASQALHAAGGGFLTTAA
FT                   WSPGNGTGRASSFGVAGILTGTVLIGLVAIVIAVPLAFGVALYISEYAPPRLRPFFTSL
FT                   IDLMAAVPSVVYGLWGFLFLEHRAVGVAHWLATYLGWIPGFQVTGARVHDPLAPLTVYT
FT                   ASTFIAGTVVGLMITPIVSSMMRESFSQAPLGEREGAYALGATRWGVIRTVVLPFGRGG
FT                   VIGGAMLGLGRALGETIAVYMIISLVFRIQPHILQAGASSVAALIAAHYGTATPFELSA
FT                   LMAAGLVLFLVTLVINLAASAIIARSRSGRDSG"
     atgacggaac agttcatccc gccggccggt cacgcccaag cggcgagcgc ggcagcgggt        60
     gcagcaggcg cgacgacggc cgcggcggcg aacgccctga cccacgtcgt cgacctcccc       120
     ccgaccgccg gcgcggagcc gccgcgcgcc gtgcgcctca aggcccgcgg cggcgaccgg       180
     gtgttcctca cggtcctggc cggcagcggc atcctggtcc tgacggtcat cgccgtcatc       240
     ggcggcttcc tcggcagccg cgcttcgcag gcgctgcacg cggccggcgg cggcttcctc       300
     accaccgcgg cgtggtcgcc cgggaacggc accggccgcg cgtcctcgtt cggggtggcg       360
     ggcatcctga ccgggacggt gctcatcggg ctggtcgcga tcgtgatcgc cgtgccgctg       420
     gcattcgggg tcgcgctcta catctccgag tacgccccgc cgcgcctgcg gccgttcttc       480
     accagcctca tcgacctgat ggccgcggtt ccgagcgtgg tctacggcct gtggggcttc       540
     ctgttcctgg agcaccgggc ggtcggggtc gcgcactggc tggcgaccta tctgggctgg       600
     atccccggtt tccaggtgac cggcgcgcgg gtgcacgacc cgctcgcgcc gctgaccgtc       660
     tacaccgcct cgaccttcat cgccggcacg gtggtggggc tgatgatcac gccgatcgtc       720
     agctccatga tgcgcgagtc gttctcgcag gcgccgctgg gcgagcgtga gggcgcctac       780
     gcgctgggcg ccacccggtg gggcgtgatc cgcacggtcg tgctgccgtt cggccggggc       840
     ggcgtgatcg gcggcgcgat gctcgggctg ggccgcgcgc tcggcgagac gatcgcggtc       900
     tacatgatca tctcgctggt gttccggatc cagccgcaca tcctgcaagc cggagccagt       960
     tcggtggcgg cgctgatcgc cgcgcactac gggacggcga cgccgttcga gctgtccgcg      1020
     ctcatggccg ccgggctggt gctgttcctg gtcaccctgg tcatcaacct ggccgcgtcg      1080
     gcgatcatcg cgcgcagccg gtccggaagg gacagcggct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page