(data stored in ACNUC7421 zone)

EMBL: CP001700.PE455

CP001700.PE455       Location/Qualifiers
FT   CDS_pept        complement(519253..519645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69410"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69410.1"
FT                   /translation="MAHTRFHVAPVPGAVGGPASAALPAWRLVGGNNRVLGRAPGCFVD
FT                   FETGYAAVLFLRERIADAVPVLGVAADTGGRTWRLEIGEVVVARSSRTYLRGRENLYNL
FT                   AHFLDSVPLAELPAPTRDERGRVCLA"
     atggcacata ctcgctttca cgtcgcaccg gttccgggcg cggtcggcgg gccggcttcg        60
     gcggcgcttc cggcctggcg cctggtcggg gggaacaacc gggtcctggg acgcgcgccg       120
     ggttgcttcg tggacttcga gaccggctac gccgccgtgc tcttcctgcg ggagcggatc       180
     gccgacgcgg tgccggtgct cggcgtcgcg gccgacaccg ggggacggac ctggcggctg       240
     gagatcggcg aggtcgtggt cgcacggtcg tctcggacgt acctgcgagg gcgggagaac       300
     ctctacaacc tcgcgcactt cctggactcc gtgccgctcg ccgagttgcc cgcgccgacg       360
     cgggacgagc gcggccgggt gtgcttggca tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page