(data stored in ACNUC7421 zone)

EMBL: CP001700.PE456

CP001700.PE456       Location/Qualifiers
FT   CDS_pept        520055..521302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0459"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: mmi:MMAR_0696
FT                   lipoprotein, LpqK"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69411"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX60"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU69411.1"
FT                   /translation="MRTALLCAALLMSAAPLVAVPAHADAGAGARRGPGECAASPAPVS
FT                   GPAGDRARAVADAVAKVRHDLKLRSVITRVTQDGRDVWTGALGPSMTGVPARTDMRFRA
FT                   GSVGIAFMGVMLMQLVDEKRVSLADPISRWLPEVPHADQITLGMLGDSTSGIQDYVKNP
FT                   AFVAELLAHPFKQWTPQELLALANPQTPLYAPGKNFSYSHANYVLLGAALERITHTRLD
FT                   RLLQQRIYPRFGLHATANSFTPDIPAPALHAFTTARGPFEESSFWNPSWTTAPGAVITM
FT                   DVCDLARAGQGVGVGTTLTRQGHQTFLNPGTVGLGTPQPYLPGGDCPAAICIPQTAAAH
FT                   YGLGALVVNGWVFQNPSFTGYAALMAYLPSQHLTIAVSVTTSADTDPDIVNAGKNVAVA
FT                   ISQALVPSNPLTFGPF"
     atgagaactg cgctgctgtg cgctgccctg ctgatgtcgg ccgcaccgct ggtcgcggtg        60
     cccgcgcacg ccgacgctgg tgccggcgcg cggcgcgggc cgggcgagtg cgccgcctcc       120
     cccgccccgg tgtcgggtcc ggcgggcgat cgggcgcgcg ccgtcgccga cgccgtcgcg       180
     aaggtgcggc acgacctgaa gctgcggtcg gtgatcaccc gcgtgacgca ggacggccgc       240
     gacgtgtgga ccggcgcgct cggaccgtcc atgaccggcg tcccggcccg gaccgacatg       300
     cgcttccgcg ccggctcggt gggcatcgcg ttcatgggcg tgatgctgat gcagctggtc       360
     gacgagaagc gggtcagcct cgccgacccg atctcgcgct ggcttcccga ggtgccgcac       420
     gccgaccaga tcacgctcgg gatgctcggc gactccacca gcggcatcca ggactacgtc       480
     aagaaccccg ccttcgtggc cgagctgctg gcgcatccgt tcaagcagtg gacgccccag       540
     gagctgctcg ccttggcgaa tccgcagacc ccgctctacg cgccgggcaa gaacttcagc       600
     tactcgcacg ccaactacgt actgctcggc gccgccctgg agcgcatcac ccacacccgg       660
     ctcgaccgcc tgctgcagca gcgcatctac ccccgcttcg ggctgcacgc gacggcgaac       720
     agcttcacgc ccgacatccc cgcccccgcg ctgcacgcct tcaccacggc gcgcggcccg       780
     ttcgaggagt cgtcgttctg gaacccctcc tggaccaccg cgcccggcgc cgtgatcacc       840
     atggacgtct gcgacctcgc ccgcgcgggc cagggcgtcg gcgtgggcac gaccctgacc       900
     cgccaggggc accagacctt cctcaacccc ggcacggtcg gcctgggcac cccgcagccc       960
     tacctccccg gcggcgactg ccccgccgcg atctgcatcc cgcagaccgc ggcggcccac      1020
     tacggcctgg gcgcgctcgt ggtcaacggc tgggtcttcc agaacccttc cttcaccggt      1080
     tacgcggccc tcatggccta cctgccgtcg cagcacctga cgatcgcggt gagcgtgacc      1140
     acctcggccg acaccgaccc ggacatcgtc aacgccggca agaacgtggc cgtggcgatc      1200
     tcgcaggcgc tcgtgccgag caacccgctg acattcgggc ccttctag                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page