(data stored in ACNUC7421 zone)

EMBL: CP001700.PE457

CP001700.PE457       Location/Qualifiers
FT   CDS_pept        complement(521339..524392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0460"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; Fibronectin type
FT                   III domain protein; type 3a cellulose-binding domain
FT                   protein; SMART: Fibronectin type III domain protein; KEGG:
FT                   tfu:Tfu_2176 endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69412"
FT                   /db_xref="GOA:C7PX61"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX61"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACU69412.1"
FT                   /translation="MRLRTPRFRITGPTATLLAGLLVANVLTLAIPTAAHAGTPSATGE
FT                   FDYAEALQDSMLFYESQRSGPLPADNRVSWRGPSDLTDGADHGLDLTGGYHDAGDEVKF
FT                   GLPEAYSMTALAWGAIDDKSGYQKSGQWQYLERDLRWGDDYIIKAHPSPHVFYGQVGDG
FT                   SSDHSFWGPAEVNPEPRPSYAVTESCPGSDLVGQASAAMAASSIVFQTDDPSYSAKLLA
FT                   QAKSLYEFADDYRGKYDACITGASSFYTSFSGYWDELVWGAIWLYKATGDTAYLTKAET
FT                   YFANLNKANQTTTPEYAWTISWDDSSYASYILLAEITGQQQYIDDAERNLDWFTTGYNG
FT                   QHVSMSPGGEAQVDVWGTARYSANEAYLALDFENWLKSQSLDTARQATYHDFAVRQMNY
FT                   ILGDNPNKESYEVGFTNGGTNTAWPQQIHNRPAHDSWDQSMSDPPNTRHLDYGLLVGGP
FT                   TSGDGFTDSRQNYQQTEGALDYNALFSGALAELTTEYGGTPRANFPPTETPDGPEELMQ
FT                   ASPNQTGSNFIEIKAEVVNKSGWPARHLTNGSFRYYFTLDAGETASQLQLTSPYSQCNA
FT                   PGPITQYSGSTYYVTISCAGDDVAPAGQSQFHREVQFRITFPAAHDYTKDWSYQDLVGM
FT                   ATNSTPVNTSHIELYDGSTKVWGTAPGSGTPVTPPGTPGTPTASAITATGATLAWAAST
FT                   PGTNAVAGYDVYSVSGATSTKVASSTTTSAPLTGLTPGTAYTFDVVARDSAGNQSPASP
FT                   TVAVTTTSSSATPPSAPTALTVTATGSTSVGLSWTAAKAGTSAIASYTVYKTGSPATAV
FT                   ATVAAPAITATVSGLTPSTVYQFYVVATDVNGLSSAASSSVSATTTAGTPPPPSSVSVQ
FT                   YETSVTTATTQSFQPLLNVVNNGTSAVPLSSVTIRYWFTSDGGSSTFATNCWYAVIGCA
FT                   KVTQSVSSVTATTGADHYVQVGFTTAAGSLAPGASTGQVQSAINKSDWSNFTQTNDYSF
FT                   NAADTAWTANTNVTVYVNGTLVWGTEPH"
     atgagactcc gcacaccccg gttccgcatc acgggcccga ccgcgacgct gctcgcgggc        60
     ctgctggtcg ccaacgtgct gacgctggcg ataccgaccg cagcgcacgc cggcacgccc       120
     tcggccaccg gcgagttcga ctacgccgag gcgttgcagg actcgatgct cttctacgag       180
     tcgcagcgct ccggcccgct cccggccgac aaccgcgtgt cctggcgcgg accgtcggac       240
     ctcaccgacg gcgccgacca cggcctggac ctgaccggcg gctaccacga cgccggcgac       300
     gaggtgaagt tcggcctgcc cgaggcgtac tcgatgaccg cgctggcctg gggagcgatc       360
     gacgacaaat ccgggtacca gaagtccggc cagtggcagt acctggaacg cgacctgcgg       420
     tggggcgacg actacatcat caaggcgcac ccctcgccgc atgtgttcta cggccaggtc       480
     ggcgacggca gcagcgacca cagcttctgg ggaccggccg aggtcaaccc cgagccgagg       540
     ccttcctacg cggtgaccga gtcctgcccg ggctcggacc tggtgggcca ggcgtccgcg       600
     gcgatggccg cgtcctcgat cgtgttccag accgatgatc cctcgtactc cgcgaagctg       660
     ctcgcgcagg cgaagtccct gtacgagttc gccgacgact accgcggcaa gtacgacgcc       720
     tgcatcaccg gcgcttccag cttctacacc tcgttcagcg gctactggga cgagctggtg       780
     tggggcgcca tctggctcta caaggcgacc ggcgacaccg cgtacctgac caaggccgag       840
     acgtacttcg ccaacctgaa caaggcgaat cagaccacga cgccggaata cgcctggacg       900
     atcagctggg acgactcctc gtacgcgtcg tacatcctgc tcgccgagat caccggccag       960
     cagcagtaca tcgacgacgc cgagcgcaac ctggactggt tcaccaccgg ctacaacggc      1020
     cagcacgtga gcatgtcccc cggcggtgag gcgcaggtcg acgtctgggg cacggcgcgc      1080
     tactccgcga acgaggcata cctggccctg gacttcgaga actggctcaa atcgcagagc      1140
     cttgatacgg cgaggcaggc cacgtaccac gacttcgcgg tgcgccagat gaactacatc      1200
     ctcggcgaca acccgaacaa ggaaagttac gaggtcggct tcaccaacgg cggcacgaac      1260
     accgcctggc cgcaacagat ccacaaccgg cccgcccacg actcgtggga ccagagcatg      1320
     agcgacccgc cgaacacccg gcacctggac tacggcctgc tggtcggcgg cccgacctcc      1380
     ggcgacggct tcaccgacag ccgccagaac taccagcaga ccgagggcgc gctggactac      1440
     aacgccctgt tctccggcgc gctcgccgag ctgaccaccg agtacggcgg cacgccgcgc      1500
     gcgaacttcc cgccgaccga gacgcccgac ggtcccgagg agctcatgca ggcctcgccg      1560
     aaccagaccg gctcgaactt catcgagatc aaggccgagg tggtcaacaa gtccggctgg      1620
     ccggcccggc acctgaccaa cggctcgttc cgctactact tcaccctcga cgccggcgag      1680
     accgcctcgc agctccagct gacctcgccc tacagccagt gcaacgcgcc gggcccgatc      1740
     acgcagtact ccggctcgac ctactacgtg acgatcagct gcgccggcga cgacgtcgcc      1800
     ccggccgggc agtcgcagtt ccaccgcgag gtgcagttcc gcatcacctt cccggcggcg      1860
     cacgactaca ccaaggactg gtcctaccag gacctggtgg gcatggcgac caactcgacg      1920
     cccgtgaaca ccagccacat cgagctctac gacggcagca cgaaggtgtg gggcaccgcc      1980
     ccgggcagcg gcacgccggt caccccgccc ggaacgcccg ggacgccgac cgcctcggcg      2040
     atcacggcca ccggcgcgac gctggcgtgg gccgcctcga ctccgggcac gaacgcggtg      2100
     gccggctatg acgtgtacag cgtgtcgggc gcgacctcga ccaaggtggc gtcctcgacc      2160
     acgacgtcgg cgccgctgac cgggctgacg ccgggcacgg cgtacacgtt cgacgtcgtg      2220
     gcgcgggaca gtgcgggcaa ccagtccccg gcatcgccga cggtcgcggt gaccaccacg      2280
     tcctcgtccg cgacgccgcc gagcgccccg accgcgctga cggtcaccgc gaccgggtcc      2340
     acgagcgtcg ggctgagctg gaccgccgcc aaggcgggga cgtcggcgat cgcgagctac      2400
     accgtctaca agaccggttc gccggcgacc gcggtcgcga ccgtggcagc tccggcgatc      2460
     accgcgactg tcagtggcct gacgccctcg acggtgtacc agttctatgt cgtggcgacc      2520
     gatgtcaatg gcctgagttc cgctgcgtca tcgagcgtat cggcgaccac cacagcgggc      2580
     actccgccgc cgccgtcgtc cgtctcggtg cagtacgaga ccagcgtcac cacagccacc      2640
     acgcagtcgt tccaaccatt gctgaacgtg gtcaacaacg ggaccagcgc ggtgccgctg      2700
     tcatcggtga ccatccgcta ctggttcacc tccgacggcg gctccagcac cttcgccacg      2760
     aactgctggt acgccgtcat cggctgcgcg aaggtcacgc agtcagtgtc ctcggtaacc      2820
     gcgacaaccg gcgccgacca ctacgtccag gtcggcttca ccaccgcggc cggcagcctc      2880
     gcccccggcg cctcgaccgg ccaggtccaa agcgcgatca acaagagcga ctggtcgaac      2940
     ttcacccaga ccaacgacta cagcttcaac gcagccgaca cggcgtggac ggcgaacacg      3000
     aacgtcaccg tctacgtcaa cggaacgctg gtctggggaa ccgaaccgca ctga            3054
//

If you have problems or comments...

PBIL Back to PBIL home page