(data stored in ACNUC7421 zone)

EMBL: CP001700.PE458

CP001700.PE458       Location/Qualifiers
FT   CDS_pept        524639..525700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0461"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: sco:SCO4754 transcriptional regulator; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69413"
FT                   /db_xref="GOA:C7PX62"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX62"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU69413.1"
FT                   /translation="MAPRRSRNGVDLTAPTTASTTTTTIAAVAEEVGVSVATVSKVLNG
FT                   RSDVAAQTRAKVEESLERHQYRRRAKKKQTGTGQVDLVFHELDSAWAMEIIRGVEAVTE
FT                   PDGVDVVLSQLGGAHHPPQHWLDAVLARRPLGVLFVLCSPTKVQQERLRRQDIPFVVVD
FT                   TDSATTASVPTVGSNNWNGGLVATRHLLELGHRRIGIISGPKDVLCSRARLAGFRAAHE
FT                   EADVEVDPDLVRYGTFYLDAGYEHGMALLDRPDRPTAVFAGSDMQALGVLRAARQLGID
FT                   VPRGLSVIGYDNLEVAAWTDPALTTIDQPIRDMAGTATRMVLDLAHGQDPSSSRIDLVT
FT                   ALVVRESTAPPAG"
     atggcacctc ggcgatcgcg gaacggcgtg gacctgaccg cgccgaccac cgcgagcacg        60
     acgaccacca ccatcgcagc cgtcgccgag gaggtcggcg tgtcggtggc gacggtctcg       120
     aaggtgctca acgggcgctc ggacgtcgcg gctcagacgc gggccaaggt cgaggaaagc       180
     ctggaacggc accagtaccg ccggcgcgcc aagaagaagc agaccggcac cgggcaggtc       240
     gacctggtct tccacgagct cgactcggcg tgggcgatgg agatcatccg gggcgtggag       300
     gcggtgaccg aaccggacgg ggtcgacgtg gtcctgtcgc agttgggcgg cgcgcaccac       360
     ccgccgcagc actggctcga cgcggtcttg gcgcggcgtc cgctcggcgt gctgttcgtg       420
     ctgtgcagcc cgaccaaggt gcagcaggaa cggttgcggc gtcaggacat accgttcgtg       480
     gtcgtcgaca ccgacagcgc caccaccgct tcggtgccca cggtcggctc caacaactgg       540
     aacggcggct tggtcgccac ccggcacttg ctggagctcg gccatcgccg gatcgggatc       600
     atctcagggc ccaaagacgt gctgtgcagc cgggctcggc tggccgggtt ccgtgccgcg       660
     cacgaggaag cggacgtcga ggtcgacccg gatctggtgc gctacggcac gttctacctc       720
     gacgccggat acgagcacgg tatggcgctg ctggatcgcc ctgaccggcc gacggcggtg       780
     ttcgccggct ccgacatgca ggccttgggc gtgctgcggg cggcgcggca gctcgggatc       840
     gacgtaccgc gcgggctgtc ggtgatcggc tacgacaatc tcgaggtcgc ggcctggacc       900
     gatccggcgt tgaccacgat cgaccagccg ataagggata tggctgggac cgccacgcgc       960
     atggttctgg atctggctca cggccaggac ccgagcagca gccggatcga cttggtcacc      1020
     gcgctagtgg tgcgggagag cactgcgccg ccggcgggct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page