(data stored in ACNUC7421 zone)

EMBL: CP001700.PE459

CP001700.PE459       Location/Qualifiers
FT   CDS_pept        complement(525818..526831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0462"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="KEGG: tfu:Tfu_1213 xylanase; PFAM: glycoside
FT                   hydrolase family 11; SMART: cellulose-binding family II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69414"
FT                   /db_xref="GOA:C7PX63"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX63"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ACU69414.1"
FT                   /translation="MPGNSRLPGARRSRRLRMFIGVVLALFLGAMLPSVPASAATSICS
FT                   NQTGTNSGYYYQMWSSGQGSACISLNSGNSYSSTWSGIGDFVAGVGWNPGDKSTKSFTG
FT                   SLNANGGTSLVSLYGWSTSPLVEYYVMENYVGSPPTAGTYMGQVTSDGGTFNIYEHQQV
FT                   NQPSIQGTATFEQYLAIRTSPVSSGTITMSNYINAWSSHGMNLGTLNYQILATEAWGGG
FT                   SGSSNVSVSSGGGGGGGGGGGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSNWTVT
FT                   MNMASPAVVYNTWNVSATWPSQYVMVAKPNGSGNNFGVTISPNGQWTWPSVSCSSS"
     atgcccggca attcacgtct ccccggtgcg cgccggagcc gtcggctccg gatgttcatc        60
     ggcgttgtgc tcgcgctgtt cctgggcgcg atgctgccgt cggttcccgc ttcggcggcg       120
     acgagtatct gctcgaacca gaccggcacg aacagcggtt actactacca gatgtggagt       180
     agcggccagg ggtcggcttg tatctcgttg aactcgggga acagctacag ctccacctgg       240
     agcgggatcg gtgacttcgt cgccggcgtg ggctggaatc ccggcgacaa gtcgacgaag       300
     tcgttcaccg ggagcctgaa cgcgaacggc ggcacctcgc tcgtctcgtt gtacggctgg       360
     tcgacgagtc cgctggtcga gtactacgtc atggagaact acgtcggttc gccccccacg       420
     gccggcacgt acatgggaca ggtcaccagc gatggtggga cgttcaacat ctacgagcac       480
     cagcaggtga accagccctc gatccagggc accgccacct tcgagcagta cctggcgatc       540
     cggacgtcgc cggtgtccag cggcaccatc accatgtcca actacatcaa cgcgtggtcc       600
     agccacggga tgaacctggg cacgctcaac taccagatcc tcgccacgga agcctggggc       660
     ggcggcagcg gtagctccaa cgtctccgtg agctccggcg gtggaggcgg cggtggcggt       720
     ggcggaggcg gcggaggagg tggcggcggc agttgtactg caacgctgtc ggccggctcg       780
     cagggcagca actggtacaa cctcaacgtc gccgtcaccg gctccagcaa ctggaccgtg       840
     acgatgaaca tggcctcgcc cgccgtcgtc tacaacacct ggaacgtcag cgccacctgg       900
     cccagccaat acgtgatggt cgccaaaccc aacggaagcg gcaacaactt cggcgtgacc       960
     atcagtccaa acggccaatg gacatggcca tcagtgtcct gtagtagctc atag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page