(data stored in ACNUC7421 zone)

EMBL: CP001700.PE46

CP001700.PE46        Location/Qualifiers
FT   CDS_pept        47443..48078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG31952"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69001"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69001.1"
FT                   /translation="MPFSHDEPASRVERVRCAVRDRTSGAAHTVSGAAGTAQSAAVTAA
FT                   GVAQGTAHQVADRATVVGQQVADRATVVAHQVADRTTVAAAAMADRARPVAAEAASRGG
FT                   AAWQVIRYGAPQPSPLARMATVIPLATVTTAARRSRAPLALMAIGAACAVGILWWRRSR
FT                   TGPDSVWILDSDSDVEPVGRWQERDNRADADDSGMDTSRRDSPANRWP"
     atgccgttca gtcacgacga gccggccagc cgtgtggagc gcgtgcgctg cgccgtccgc        60
     gaccggacgt ccggcgccgc ccacacggtc tccggcgccg ccggaaccgc ccaatccgcc       120
     gcggtgaccg ccgccggcgt ggcccagggc accgcccacc aggtcgcgga ccgcgccacc       180
     gtcgtcggcc agcaggtcgc cgaccgggca accgtggtcg cccaccaggt ggcggaccgc       240
     accacagtgg ccgccgcggc catggccgac cgcgcccgcc ccgtggccgc cgaggcagcc       300
     tcccgaggcg gcgccgcctg gcaggtcatc cgctacggag ccccccagcc ctcacccctg       360
     gcccgcatgg ccaccgtgat ccccctggcg acagtgacca cagcagcccg ccgcagccga       420
     gcccccctcg ccctgatggc catcggcgcg gcctgcgccg tcggcatcct ctggtggcgc       480
     cgctcccgca ccggcccgga cagcgtctgg atcctcgact ccgacagcga cgtcgaaccc       540
     gtgggccgct ggcaggaacg cgacaaccga gccgacgccg acgactccgg catggacacc       600
     tcccgccgcg actcccccgc caaccgctgg ccctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page