(data stored in ACNUC7421 zone)

EMBL: CP001700.PE460

CP001700.PE460       Location/Qualifiers
FT   CDS_pept        527220..527909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69415"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69415.1"
FT                   /translation="MPELIPRLMAPFLPEETRYRLRQHKLDIEAAEKAARILPLPGVTI
FT                   TVLHSTTGARSWRETTLVPTSTPPHMTAWWFTKGSLAWDGNLLTVTGDNDTSPHWPTAQ
FT                   GGVQPEFSADNVAQARHRPVTSGECPAAVVEIASISLRGQRPRRLYFLDEESRHLTMTP
FT                   ARGFTEDQLTTFAHHAGLTYRTYALTTGGKTTPDAMCEALFPRSARRRRVISEHSPSVE
FT                   WQWQGWP"
     atgcccgagt tgataccgcg gctgatggcg ccgttccttc ccgaggagac gcgctatcgc        60
     ctcaggcagc acaagctcga catcgaggcg gccgaaaagg cggcgcgaat actccccttg       120
     ccgggcgtca cgataacggt gctccactcc acaaccggcg cgcgatcctg gcgcgagacc       180
     accctggtcc ccacctcgac gcccccgcat atgaccgcct ggtggttcac caaaggcagc       240
     ctggcctggg acggcaacct cctcaccgtg accggcgaca acgacacctc accccactgg       300
     cccaccgccc aaggcggcgt ccaaccagaa ttctccgcag acaacgtcgc ccaagcccgc       360
     caccgccccg tgacctccgg cgaatgccca gccgcggtcg tggagatcgc atccatctcc       420
     ctccggggcc aacgcccccg ccgcctctac ttcctcgacg aagaatcccg ccacctcacc       480
     atgacccccg cccgaggctt caccgaagac caactcacca ccttcgccca ccacgccggc       540
     ctcacctacc gcacctacgc cctcaccacc ggcggcaaaa caaccccaga cgccatgtgc       600
     gaagccctgt tcccccgttc agcacgccgc cgccgagtaa tcagcgagca cagcccgagc       660
     gtcgagtggc aatggcaggg gtggccgtaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page