(data stored in ACNUC7421 zone)

EMBL: CP001700.PE461

CP001700.PE461       Location/Qualifiers
FT   CDS_pept        528026..529117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69416"
FT                   /db_xref="GOA:C7PX65"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69416.1"
FT                   /translation="MASRLFDGALINDEPILKAQLKRTWRMLLMVVSASMAVVGLVFVV
FT                   LRNHFGASSDIHNVVLEVGVNLALFGCTTLLVTVIASQQLEHQILGELNTRLNAHVKNV
FT                   GDTMNEVQSEFRKTIETFLPLFGNGRDLGLDNIFLTRTDALIDIESHLRDELKSAAVES
FT                   SRTGGPDDRDGPRARLWFVGTSLKGILEASALGFDGAGILSWAASLAAQDLLDLRVLLT
FT                   HPTFARVRARQEHRAGTAIPEEISEALEFLHAHQVNAACIRMTQASPTVFAIATRERML
FT                   LNPYPYGAEAHRSFSIIVKRVHQEPNDHDSLHRDIFEQYEQRHFVRPWDDGLPVEQGAK
FT                   EDPFVIPEATFNPLRPDGGDPAA"
     atggcgagca ggctgttcga cggtgcgctg atcaacgatg agccaatact caaggctcag        60
     ttgaaacgca cctggcggat gctgctgatg gtggtatccg cgtcgatggc ggttgtgggc       120
     ttggttttcg tcgtccttcg caaccacttc ggcgccagtt cggacattca caatgtggtt       180
     ctggaagtcg gcgtcaacct ggcgctgttc ggctgcacga cgctgttggt gacggtgatc       240
     gcgtcgcaac agctcgaaca ccagatcctc ggagaactca acactcgcct gaacgcgcac       300
     gtcaagaacg tcggcgacac catgaacgag gtgcagagcg agttccgcaa aaccatcgag       360
     acctttctgc cgctcttcgg caacggccgc gacctcggtc tggacaacat cttcctgact       420
     cggaccgacg ccttgatcga catcgagagc catctgcgcg acgagttgaa gagcgcggcc       480
     gtggaaagct cccggaccgg gggtcccgac gatcgcgacg gaccccgcgc gcggctatgg       540
     ttcgtcggca catcgctgaa aggcatcctg gaggcctcgg cgctgggatt cgacggcgcc       600
     ggcatcctgt cctgggcagc ctccctcgcc gcccaggatc tgctggatct cagagtcttg       660
     ctgactcacc cgaccttcgc ccgagtacgc gcccgccagg aacaccgagc agggacagcc       720
     atccccgagg aaatcagcga ggccttggag ttcctccacg cgcaccaagt caacgccgcc       780
     tgcatccgca tgactcaggc ctcgcccacc gtcttcgcca tcgcgacccg cgaaaggatg       840
     ctgctgaatc cgtaccccta cggcgccgag gcgcaccgaa gcttctccat catcgtcaag       900
     cgcgtccacc aggagccaaa cgaccacgac tccctccacc gcgacatctt cgagcagtac       960
     gaacaacgac acttcgtccg cccctgggac gacggcctgc ccgtggaaca aggggcaaag      1020
     gaagatccat tcgtgatccc cgaggccacc ttcaaccccc taagacccga cggcggcgat      1080
     cccgcagcct ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page