(data stored in ACNUC7421 zone)

EMBL: CP001700.PE463

CP001700.PE463       Location/Qualifiers
FT   CDS_pept        529713..529970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69418"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX67"
FT                   /inference="similar to AA sequence:KEGG:SCO3733"
FT                   /protein_id="ACU69418.1"
FT                   /translation="MRFTIAGCSFHLQASDVEQAMSGIKGEPISGACVRIGRRWYPVKQ
FT                   VGAVITGQDRRDFSGAEVTHALERLGYTCRPTPPDAPAQA"
     atgcgcttca cgatcgccgg atgttccttc cacctgcaag cgagtgatgt cgagcaagcg        60
     atgagcggga tcaagggcga gccgatctcc ggcgcgtgtg tgcggatcgg ccggcgctgg       120
     tatccggtca agcaggtggg ggcggtgatc accggtcagg accgccgaga cttcagtggc       180
     gcggaggtca cccatgcgct cgagaggctg ggctacacct gccgtcccac gcctccggac       240
     gcccctgctc aggcgtag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page