(data stored in ACNUC7421 zone)

EMBL: CP001700.PE464

CP001700.PE464       Location/Qualifiers
FT   CDS_pept        complement(530033..531388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0467"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ace:Acel_1594 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69419"
FT                   /db_xref="GOA:C7PX68"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX68"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69419.1"
FT                   /translation="MNLRTRLAVAGGSIVAGALVLVSVVLYPAVDTSLRGQIDKALATA
FT                   AAQAPDVAAYIKSQNAPPDGQTPAAPLFPPISMGIGTTKLQIIPSDVVRIGPSAQFIDV
FT                   SAHDVSVALGGTGPYFQDATYNGVAYRVYTMPFPDSRGSLVRTAIPESDPAPTLHELAW
FT                   LLAASTVAAGLLAALAARLAARRVLRPVGRLTETVELIRATGDLTIPIPAASRDEIGRL
FT                   GAAFSAMTSALDESVGAQRRLVADASHELRTPLTSLTVNLELLAENPSDAQAPLLAAEA
FT                   LGQAGELKALVNDLVDLARFGQAAFHTEDVRLDLVAERVAARAARRAPRIDFELRCAPT
FT                   WVHGDPDALERAFANLVDNAVKWSPAGGRVRISVVKGVVEIADDGPGIPDSDLDFVFDR
FT                   FYRSPAARAHPGSGLGLAIVRQVAETHGGTARAVRCSTGALLRLTLPVSGEA"
     gtgaacctgc gcacgcgtct ggccgtggcg ggcgggtcga tcgtcgccgg cgcgttggta        60
     ctggtgtcgg tggtcctgta cccggccgtg gacaccagtc tgcgaggcca gatcgacaaa       120
     gccttggcca cagcagccgc tcaggcgccg gacgtggccg cgtacatcaa gtcccagaac       180
     gcgccgccgg acggccagac accggcggca ccgctgttcc cgccgatctc gatggggatc       240
     ggcacgacca agctgcagat cattccctcg gacgtggtcc ggatcggtcc gtcggcgcag       300
     ttcatcgacg tctccgccca cgatgtctcg gtcgcgctgg gcggcaccgg accgtacttc       360
     caggacgcga cgtacaacgg cgtcgcctac cgcgtctaca ccatgccgtt ccccgacagc       420
     cggggatcgc tcgtccgcac cgccatcccg gagtccgacc cggctccgac gctccatgaa       480
     ctcgcctggc tgctcgcggc gtcgacggtc gcagccggac tcctggcggc actggcggcg       540
     cggctcgcag cgcggcgcgt cctgcgtccg gtgggacggc tcaccgagac cgtcgagctc       600
     atccgcgcga ccggcgatct gacgatcccg atcccggccg ccagccgcga cgagatcgga       660
     cgcctagggg cggcgttctc cgcgatgacc tccgcgttgg acgagtcagt cggggcgcag       720
     cgacggctgg tcgcggacgc ttcgcacgaa ctgcgcacgc ccctgacgag cctgacggtc       780
     aacctcgagc tgctggcgga gaacccgtcc gacgcgcagg cgccgctgct ggccgccgag       840
     gcgctgggac aggcgggaga gctcaaggcc ctggtcaacg atctcgtgga tctggcacgg       900
     ttcggccagg ccgcgttcca caccgaggac gtccggctcg acctcgtcgc cgaacgcgtg       960
     gcggcccgag cggcgcgccg ggcaccccgg atcgacttcg agctgcggtg cgcgccgacg      1020
     tgggtgcacg gcgacccgga cgcgctggag cgcgcattcg cgaacctggt cgacaacgcc      1080
     gtgaagtgga gcccggccgg cggacgagta cggatcagcg tcgtgaaggg ggtcgtcgag      1140
     atcgccgatg acggccccgg catccccgac agcgacctgg acttcgtctt cgaccgcttc      1200
     taccgctccc ccgcggcccg cgcgcacccc ggctccgggc tcggcttggc gatcgtccgc      1260
     caggtcgccg agacccacgg cggcacggct cgggccgtac ggtgctccac cggcgcgctg      1320
     ctgcgtctga cgctgcccgt cagcggcgag gcgtag                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page