(data stored in ACNUC7421 zone)

EMBL: CP001700.PE465

CP001700.PE465       Location/Qualifiers
FT   CDS_pept        complement(531385..532056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0468"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: cur:cur_0545 two-component system response
FT                   regulator MprA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69420"
FT                   /db_xref="GOA:C7PX69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX69"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69420.1"
FT                   /translation="MRILVVDDDPAVRRSLEHALRRDGYDVVSVADGTSALAEHVAFRP
FT                   DAVVLDILMPEPNGLEVCRALRSAGDDTPILMLTARDLVTDRVAGLDAGADDYLAKPFA
FT                   LEELRARLRALLRRSGAQSEVLTFADVRLDLSGWRVERGGRRLELTKTELSLLELFLRN
FT                   PQHVLSRTQIFESVWGYDFGPQSNALWVYISYLRGKLEADGGARLIQTVRGLGYVLREE
FT                   P"
     atgcggatac tcgtggtgga cgacgacccg gcggtgcgcc ggtccctgga gcacgcgctg        60
     cgccgggacg ggtatgacgt cgtgtcggtc gccgacggga cgtccgcgct cgcggagcac       120
     gtcgccttcc ggccggacgc ggtggtcctc gacatcctca tgcccgagcc gaacgggctc       180
     gaggtctgtc gggccctgcg ttcggccggg gacgacaccc cgatcctgat gctgacggcc       240
     cgggacctgg tcaccgaccg ggtcgccggg ctcgacgcgg gagcggacga ctacctggcg       300
     aagccgttcg cgctggagga gttgcgcgca cgcctgcggg ccctgttgcg acgcagcggc       360
     gcgcagtccg aggtgctgac gttcgccgac gtccggctcg atctgagcgg gtggcgagtg       420
     gagcgcggcg gtcggcgcct ggagctgacc aagacggagt tgtcgctgct ggagctgttc       480
     ctgcgcaatc cgcagcacgt gctcagtcgg acgcagatct tcgagtccgt ctggggctac       540
     gacttcgggc cgcagtcgaa cgctctgtgg gtctatatca gctatctgcg aggcaagctc       600
     gaggccgatg gcggcgccag actgattcag acggttcgcg gactcggcta cgttctgcgc       660
     gaggagccgt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page