(data stored in ACNUC7421 zone)

EMBL: CP001700.PE466

CP001700.PE466       Location/Qualifiers
FT   CDS_pept        complement(532141..532827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpl:lp_0373 cell surface protein precursor
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69421"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69421.1"
FT                   /translation="MVKRKRVVAVVVAIAALGATGTASAATSGNTPAPSPTKSGAPAVA
FT                   GNDTSVDKSAGKSDGKSDGKSADAGKDEFAALAAKLGVTTDRLNAAMVAAKMSLASTNG
FT                   GTPQAFYAAIAANLGLPVARVQDALGTEIFRKGPEGGKPSKHGVPGPSPFTTDSAAAFV
FT                   AHELGVDQKKAKTALAAVVALDDARGGVDPTSKAFGDIAASLGVSSSRLATALTDLKMS
FT                   IGGTKG"
     atggtgaaac gcaagagggt cgtcgcagtc gtggtggcga tcgcggctct gggcgcgacc        60
     gggacggcct cggcagcgac atcggggaac acgccggcgc cgagcccgac gaagtccggc       120
     gctcccgcgg tcgccggaaa cgacacgtcc gtcgacaagt ccgccggcaa gtccgacggc       180
     aagtccgacg gcaagtccgc cgacgcgggg aaggacgagt tcgccgccct cgccgcgaag       240
     ctcggggtga cgacggatcg gctcaacgcc gcgatggtcg ccgccaagat gtcgctggcc       300
     tcgacgaacg gcggtacccc gcaggcgttc tacgcggcga tcgccgcgaa tctggggctg       360
     ccggtggcgc gggtccagga cgcgctgggg acggagatct tcaggaaggg accggagggc       420
     ggcaagccga gtaagcacgg cgtgcccggg ccctctccgt tcaccacgga ctcggcggcg       480
     gcgttcgtgg cgcacgaact cggtgtcgac cagaagaagg ccaagaccgc gctggccgcg       540
     gtggtcgctc tggacgacgc tcgcggtggg gtcgacccga cgtccaaggc gttcggggac       600
     atcgccgcgt cgctcggcgt cagctccagc aggttggcca ccgcgctcac cgacctgaag       660
     atgtcgatcg gtggcacgaa gggctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page