(data stored in ACNUC7421 zone)

EMBL: CP001700.PE467

CP001700.PE467       Location/Qualifiers
FT   CDS_pept        complement(532923..533627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0470"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: fra:Francci3_2444 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69422"
FT                   /db_xref="GOA:C7PX71"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX71"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69422.1"
FT                   /translation="MRVLVVEDVRRLADDIGEGLRDQGMAVDIAYDGLTASEKCASTDY
FT                   DVVVLDRDLPGLHGDVLCRQIAESANPALVLMLTAAGSPGERVQGLRLGADDYLPKPFH
FT                   FPELVLRVQALARRRPAARPRVLRAAGIELDPTLRTATRLGRPLRLSPKEFEVLAALLA
FT                   AAPAPMSAEHLLEKVWDENADPFTRTVSVTVGRLRRKLGAPDVVVTIAGAGYGIGVSGD
FT                   EDGSSGAVLREL"
     gtgagggtcc tggtcgtcga ggacgtccgc cggctcgccg acgacatcgg cgagggactg        60
     cgggatcagg gcatggcggt ggacatcgcc tacgacggcc tgacggcctc ggagaaatgc       120
     gcttcgacgg actacgacgt cgtggtcctc gaccgggacc tcccgggtct gcacggagac       180
     gtgctctgcc gccagatcgc cgagtccgcg aacccggcgc tggtcctcat gctcaccgca       240
     gccggttcgc cgggcgaacg cgtccagggc ctgcgcctcg gcgccgacga ctacctgccc       300
     aagcccttcc acttccctga gctggtgttg cgcgtccagg ccttggcccg gcgccgcccc       360
     gcagcccggc cgcgcgtgct gcgggcggcc ggcatcgaac tggacccgac gctgcgcacg       420
     gcgaccaggc tcggccggcc gctgcggctg tcgccgaagg agttcgaagt cctcgccgcc       480
     ctgctcgcgg cggcacccgc gccgatgagc gcggaacacc tgctggagaa ggtgtgggac       540
     gagaacgccg atcccttcac ccgcaccgtc tcggtcacgg tcggccggct gcggcgcaaa       600
     ctcggcgcgc cggacgtggt cgtgacgatc gccggtgccg gctacggaat cggtgtgtca       660
     ggggacgaag atgggtcgtc cggcgccgtt ctgagggaac tctaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page