(data stored in ACNUC7421 zone)

EMBL: CP001700.PE468

CP001700.PE468       Location/Qualifiers
FT   CDS_pept        complement(533624..534736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0471"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   fra:Francci3_2445 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69423"
FT                   /db_xref="GOA:C7PX72"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX72"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69423.1"
FT                   /translation="MRLTLLYAALFLASGIVLLAVALYLVFRNPILVTFDPTPPSLPSP
FT                   MPGRSDVLRVFRPATGTVSPTWATVRAAAAQSAGVLAAMAAVSTLLGWIVAGRVLSPLR
FT                   TMAFRTRRISEQNLHERLALTGPRDEMTELATTIDGLLGRLEAAFEAQRRFIANASHEL
FT                   RTPLAMMRTSLDVAVAKPGRPREVDVLGGKLREGLDAADRLLEGLLLLARTQNVERMET
FT                   SAVSLPDLLDAALHARRATIEDKRLLVEQKVEPVLYRGNDTLLASLVDNLVDNAIRHNE
FT                   PGGWLRAQVTVPRGEHDRTRIIVENGGPLLTRAEVDLLGQPFQRLGSQRTSQPGTGLGL
FT                   SIIAAIAEVHHGRLLLQARDEGGLRAEVEL"
     atgcggttga cgctgcttta cgcggcgctg ttcctcgcct ccggcatagt gctgctcgcc        60
     gtcgcgctgt atctggtgtt ccgcaacccg atcctggtca cgttcgaccc gacgccgccg       120
     agcctgccgt cgccgatgcc gggcaggtcc gacgtgctgc gcgtcttccg gccggccacc       180
     ggaacggtca gtcccacctg ggccaccgtg cgcgcggctg ccgcacagtc ggccggggtc       240
     ttggcggcga tggccgcggt gtcgaccctg ctgggctgga tcgtcgccgg ccgggtactc       300
     agtcctctgc gaaccatggc gttccggacg cgccgcatct ccgagcagaa cctgcatgaa       360
     cgcctggcgc tcaccggtcc gcgcgacgag atgacggagc tggccaccac gatcgacggt       420
     ctgctcggcc ggctggaagc cgccttcgag gcgcagcgcc ggttcatcgc caacgcctcg       480
     cacgagctgc ggaccccgtt ggccatgatg cgtacctccc tcgatgtcgc ggtcgccaag       540
     ccgggacgac cgcgcgaagt ggacgtgttg ggcggcaaac tacgcgaagg cttggacgcc       600
     gcggaccggt tgctggaagg cctgctgctg ttggcccgga cccagaacgt cgagcggatg       660
     gagacctctg ccgtgtcgtt gccggacctg ctcgacgccg cgctccacgc gcgcagggcc       720
     acgatcgagg acaagcgcct cttggtggaa cagaaggttg agcccgtgct gtaccgaggc       780
     aacgacacgt tgctggcaag tctcgtggac aacctcgtgg acaacgcgat ccgccataac       840
     gagcccggcg gctggttgcg cgcacaggtc acggtcccgc gcggcgagca tgacagaacc       900
     cgcatcatcg tcgagaacgg cgggccgctc ttgacccggg ccgaagtgga cctgctcggg       960
     cagccgttcc aacgcctcgg ctcgcaacgg acgtcgcagc cgggcaccgg cttgggcttg      1020
     tccatcatcg cggcgatcgc cgaggtgcat catggcaggc tgctgctcca ggcccgggac      1080
     gagggcggac tgcgcgcgga ggtggagctg tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page