(data stored in ACNUC7421 zone)

EMBL: CP001700.PE469

CP001700.PE469       Location/Qualifiers
FT   CDS_pept        534855..536432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0472"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; TAP domain
FT                   protein; KEGG: sco:SCO7650 secreted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69424"
FT                   /db_xref="GOA:C7PX73"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX73"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69424.1"
FT                   /translation="MKLSKRNGVAALGLALGVAGVGLSGTASATPDAASQASAISAITW
FT                   QACPQYSDDVLGAVGIQPKDRAAFRDMWARTDCGTVSVPQDYRHPEGQHVTIAFTRLKA
FT                   KDQAHRQGILFMNPGGPGGSGYLMPEQVALQNPSDAQLNDQYDLIGFDPRGIGYSTSED
FT                   CAGFLNGPPPQSGQLTKAQVKQAYDASAKTNAECSSSDPAFLGQLTTANAARDLDQLRR
FT                   ALHESQASYFGVSWGTQLGAVYRSMFPATIHRMWLDSVVSPRAYDLAYRMDGAAQSVEQ
FT                   DFGLFATWLAQHDDVYGLGTTAQSVTARVLALRKQGDAHPWQFSDLSEPLDGGFIASLA
FT                   SSQNTDWEQAAAVLKSMTAAVSGQPAPPGVKAVANGHGPLPPPPSGAPQAFNPTAQQAY
FT                   LCNEDDSSRAFEPLWDEYQRNLQRDPVTGDLTALRPTCAGWNLPVQHFTLRYSPGSLQM
FT                   SGHEYETLTPYPWVWQMQQAIGGTVFTVDDFRHGSLALVPECASHLIAYFETGKADSGS
FT                   CPGLQPSA"
     atgaaactca gtaaacgcaa cggcgtcgcc gctctcgggc tcgccttggg cgttgccggc        60
     gtcggtctgt ccggcaccgc gagcgcgacg ccggacgccg cgtcgcaggc ttctgcgata       120
     tctgccatca cctggcaagc gtgtccgcag tattccgacg atgtcctggg agccgtcggc       180
     atccagccga aggaccgggc ggcgttccgg gacatgtggg cacgcaccga ctgcgggacg       240
     gtgagcgtcc cgcaggacta ccggcatccg gagggacagc atgtcacgat cgcgttcacc       300
     cggctgaaag ccaaggacca ggcgcaccgc cagggaatcc tgttcatgaa ccccggggga       360
     ccgggcggca gcggttacct gatgccggag caggtggcct tgcagaaccc ctccgacgcg       420
     cagctcaacg accagtacga cctgatcggc ttcgacccgc gcgggatcgg ctacagcacc       480
     tccgaggatt gcgcgggctt cctcaacggt ccgccgccgc agtccgggca gctgacgaag       540
     gcgcaggtga agcaggcgta cgacgcatcg gcgaagacca acgccgagtg ctcctcgtcg       600
     gaccccgcgt tcctggggca gctcacgacc gcgaacgcgg cgcgggatct ggaccaactg       660
     cggcgcgcgc tgcacgagtc gcaggcgagc tatttcggcg tctcgtgggg cactcagctc       720
     ggggcggtgt atcggagcat gttcccggcg acgatccatc ggatgtggct ggacagcgtc       780
     gtctcgcccc gcgcctacga tctggcgtac cgcatggacg gcgccgcgca gagcgtggaa       840
     caggacttcg gactgttcgc gacatggctg gcgcagcacg acgacgtcta cggcttgggc       900
     accaccgctc agtcggtgac cgcgcgagtg ctggccttgc gcaagcaggg cgacgcgcat       960
     ccctggcagt tctctgacct gagcgagccg ctggacggtg ggttcatagc gtccctcgcg      1020
     agttcgcaga acactgactg ggagcaggct gcggccgtcc tgaagagcat gacggccgcg      1080
     gtctccgggc aaccggcccc gcccggagtg aaggccgtcg ccaacggcca cggcccgctc      1140
     cccccgccgc ccagcggcgc cccgcaggcc ttcaacccga cggcgcagca ggcctacctg      1200
     tgcaacgagg acgacagctc ccgcgccttc gaaccgctct gggacgagta ccagcgcaac      1260
     ctccagcgcg acccggtcac cggcgacctc acggcactgc gccccacctg cgcgggatgg      1320
     aatctgccgg tgcagcactt cacgctgcgc tacagcccag gctcgctcca gatgtcaggg      1380
     cacgaatacg agacgctgac cccgtacccg tgggtgtggc agatgcagca agccatcggc      1440
     ggaaccgtgt tcaccgtcga cgacttccga cacggttcgc tggcgctggt gcccgagtgc      1500
     gcctcccacc tgatcgcgta cttcgagacc ggcaaggccg actcgggttc gtgccccggc      1560
     ttgcagccca gcgcgtag                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page