(data stored in ACNUC7421 zone)

EMBL: CP001700.PE47

CP001700.PE47        Location/Qualifiers
FT   CDS_pept        complement(48321..49223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3551 membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69002"
FT                   /db_xref="GOA:C7QFR3"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69002.1"
FT                   /translation="MPPPNPARDRGSATIYAALLTGLLTTLTGAILALGTAILARHRAG
FT                   SAADLAALSAATHATPGQIPCDWARRVTTAHHTRLLHCTCNGPTCLVTTAINTPWGAAT
FT                   VTSRAGPADDPTGETTAGQNALRAEGTRLAEAAMGLRAAALSDPVGERIAGIERTRLGE
FT                   ATGGSLRTAAMTSRTHDPVGERTVEVERSSRAKPQATAPRAANLVGRTGLTHGLVGPSL
FT                   VGIERSTYAEAYPFGKRASGIAARLTTPAVASRPRPSPHRAPVVPAAPLVGVRLAVAES
FT                   EPLAGSSAASCCQLGAALP"
     atgccgccgc cgaaccccgc ccgtgaccgc ggctcagcca cgatctacgc cgcactcctg        60
     accggcctac tgacaaccct caccggcgcg atcctcgccc tcggcaccgc gatcctcgcc       120
     cgccaccgag ccggatccgc cgccgacctc gccgccctca gcgccgccac ccacgccacc       180
     cccggccaaa tcccctgcga ctgggcccgc cgagtaacca ccgcccacca cacccgcctg       240
     ctccactgca cctgcaacgg cccaacctgc ctggtcacca ccgccatcaa cacgccatgg       300
     ggcgccgcga ccgtaaccag ccgcgccggc cccgccgacg accccaccgg agaaaccacc       360
     gccgggcaga acgccctcag ggctgagggc acccgcctcg ccgaagccgc catgggtctg       420
     cgagccgcag ccttgagcga tcccgttgga gagcgcatcg ccgggatcga acggactcgc       480
     cttggtgaag ccactggagg cagcctgcga accgcagcca tgaccagccg gacccatgat       540
     cccgtcggag agcgcaccgt cgaggtcgag cggagcagcc gcgcgaagcc acaggctacc       600
     gcgccgcgtg ccgcgaacct ggtcggccgc accggtctca cccatggtct cgtcgggcca       660
     agcctcgttg ggatcgagcg gagcacttac gccgaggctt atcccttcgg caagcgcgcc       720
     agcgggatcg ctgctcgcct gaccacccct gccgtcgctt cccgtccccg cccttcgccg       780
     caccgcgccc cagtcgtccc agccgctcca ctcgtcggtg ttcgtctcgc tgtcgccgaa       840
     tccgagccac tggctggctc gtcggctgcg tcgtgctgcc agttgggcgc agcgctcccc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page