(data stored in ACNUC7421 zone)

EMBL: CP001700.PE470

CP001700.PE470       Location/Qualifiers
FT   CDS_pept        536641..538062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_1931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69425"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX74"
FT                   /inference="similar to AA sequence:KEGG:SAV_1931"
FT                   /protein_id="ACU69425.1"
FT                   /translation="MAESRRGVVTGRPYLTPEERVKRGRSARRDAPRSSHGEWEPAPDR
FT                   RPVIDQLEAQASTSVADLVPIRYGRMIESPFRFYRGAASIMAADLASTPRSEMRAQLCG
FT                   DAHLLNFRLLGSPERRLVFDINDFDETLRGPWEWDVKRLAASLAIAGRENGFDDHQREI
FT                   VVRTMAGGYREAMRAFAGMTSLDVWYAHGSTERIRELYTDQLDAQRRKNFRRMLEKAKG
FT                   RDSLQAAEKLTTTVDGRPRIVADPPLVVPLADLLPDLERGEVEAWIRDLVRRYSRSLRS
FT                   DLRMLLDQYRVVDMARKVVGVGSVGTRCWIVLLAGSDEQDPLFLQIKEANRSVLADYAG
FT                   ESPYAHQGHRVVAGQRLMQAVGDILLGWKRGEDAHGGSHDFYVRQLRDWKGILESRTMV
FT                   PHSMRIFGELCGATLARAHARSSDRIAIASYLGKGDGFDRALARFAEVYADQNERDHQA
FT                   LVEAVDRGRIRAQAA"
     atggccgagt ccaggagggg cgtcgtcacc ggacgcccgt atctgacccc cgaagaacgt        60
     gtgaagcgcg gacgctccgc ccggcgcgac gcaccccggt cgagccacgg cgagtgggag       120
     cccgcccccg atcgccggcc ggtgatcgac cagttggagg cgcaggcctc gacgtcggtc       180
     gcggacctcg tgccgattcg ctacggccgg atgatcgagt cccccttccg cttctaccgt       240
     ggagccgcat ccatcatggc cgcggacctg gcctcgactc ccaggtccga gatgcgggcg       300
     cagctgtgcg gggacgcgca ccttctcaac ttccgcctgc tgggctcacc ggagcgccgg       360
     ctggtcttcg acatcaacga cttcgacgag acactgcgcg gcccatggga atgggacgtc       420
     aagcggctcg ccgccagcct cgccatcgcc ggccgggaga acggcttcga cgaccaccag       480
     cgcgagatcg tggtgcggac catggccggc ggctatcgcg aggccatgcg cgcgttcgcc       540
     ggaatgacca gcctcgatgt ctggtacgcg cacggcagca ccgagcgcat ccgcgagctc       600
     tacaccgatc agctcgacgc gcaacgccgg aagaacttcc ggcgcatgct ggagaaggcc       660
     aaaggccggg acagtctgca agcggctgag aagctgacca cgacggtcga cgggcgtccg       720
     cgcatcgtcg ccgatccacc actcgtcgtc ccgctcgccg acctgctccc ggacctggaa       780
     cgtggagagg tcgaggcgtg gatccgggat ctggtccggc gctacagccg cagcctgcgc       840
     tccgatctgc gcatgctgct cgaccagtac cgcgtcgtcg acatggcccg caaggtcgtc       900
     ggcgtcggca gcgtcggcac ccggtgctgg atcgtgttgc tggccggctc cgacgaacag       960
     gatccgctgt tcctccagat caaggaggcc aaccgctccg tgctggcgga ttacgccggc      1020
     gagagccctt acgcgcacca gggccaccgc gtcgtggccg gacagcggct gatgcaggcg      1080
     gtcggggaca tcttgctggg ctggaagcgg ggcgaggacg cgcacggcgg atcgcacgac      1140
     ttctacgtca ggcagctccg tgactggaag ggcatcctcg agtccagaac catggtgccc      1200
     cattcgatgc gcatcttcgg agagctctgc ggagccactc tggcccgtgc tcacgcccgc      1260
     tcctccgacc ggatcgcgat cgcttcgtac ctcgggaagg gcgacgggtt cgatcgcgcg      1320
     ctcgcccggt tcgccgaggt ctacgccgac cagaacgaga gggatcacca agcgctcgtc      1380
     gaggcggtcg accgcggccg gatccgcgca caggctgcgt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page