(data stored in ACNUC7421 zone)

EMBL: CP001700.PE471

CP001700.PE471       Location/Qualifiers
FT   CDS_pept        complement(538153..539637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0474"
FT                   /product="glycoside hydrolase family 11"
FT                   /note="PFAM: glycoside hydrolase family 11; Ig family
FT                   protein; cellulose-binding family II; SMART:
FT                   cellulose-binding family II; Dystroglycan- type cadherin
FT                   domain protein; KEGG: sde:Sde_3061 xylanase/chitin
FT                   deacetylase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69426"
FT                   /db_xref="GOA:C7PX75"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX75"
FT                   /inference="protein motif:PFAM:PF00457"
FT                   /protein_id="ACU69426.1"
FT                   /translation="MLAGVMALLPGTAGAATTICSSQTNTVSGYWYSFWTEGSGSACMT
FT                   FGSAGNYSTSWSNAGNFVAGLGWSTGGRKTVSYSGSFNPSGNGYLSLYGWTTNPLVEYY
FT                   ITDSWGSYRPTGTYKGTVTSDGGTYDIYETTRYNEPSIIGTATFNQYWAVRQSKRVGGT
FT                   ITTGNFFDAWASHGMNMGQYNYMILATEGYQSSGNSNITIGGSVTNTVTVTNPGSQSTT
FT                   AGSPASVQVHASDSASGQTLAYTASGLPPGLSINSGSGLISGTPTTPGSYQVTVTGTDT
FT                   TGAKGSATFTWTVGSETGTLVTVTSPGNQTGSVGTAISPIQIQATDSAGQALTYSATGL
FT                   PAGLSISSSGVISGTPTAAGTSDVTVTASDSSGSGSATFTWSISGGGTTTGVCHATYAR
FT                   TSEWPGGFTANVTIANTGTTAVNGWTLGWSFPGDQKITNAWSATATQSGSNVTATNVAY
FT                   NGSIAPGGTTSFGFQGTYGSNDSSPTAFTLNGTACS"
     atgctcgccg gcgtcatggc gctcctgccc ggaaccgccg gcgcggcgac gaccatctgc        60
     tccagccaga ccaacaccgt cagcgggtat tggtactcgt tctggaccga aggcagtggt       120
     tcggcctgca tgaccttcgg gtccgccggc aactacagca cctcctggag caatgccggc       180
     aacttcgtcg ccggtctggg ctggagtact ggcggacgca agacggtgag ctactccggc       240
     agcttcaacc cctccgggaa cggttacctg tcgctgtacg gctggaccac caacccgctg       300
     gtcgagtact acatcaccga cagttggggc agctaccggc cgaccggcac ctacaagggc       360
     acggtcacca gtgacggcgg cacctacgac atctacgaga cgacgcggta caacgaaccg       420
     tccatcatcg ggaccgcgac gttcaaccag tactgggcgg tccggcagtc caagcgggtg       480
     ggcggcacca tcaccaccgg caacttcttc gacgcctggg ccagccacgg catgaacatg       540
     ggccagtaca actacatgat cctggccacc gagggctacc agagcagcgg caactcgaac       600
     atcaccatcg gcggcagcgt cacgaacacg gtgaccgtga ccaacccggg cagccagagc       660
     acgacggccg gcagcccggc gagcgtgcag gtccacgcct cggactcggc gtccggccag       720
     accctcgcct acaccgcctc cggcctcccc ccgggcttgt cgatcaacag tggcagcggg       780
     ttgatctccg ggacgccgac cactcccggg tcctaccagg tcaccgtcac ggggaccgac       840
     accaccggag ccaaggggtc ggccacgttc acctggacgg tcggctcgga gaccgggacc       900
     ctcgtgaccg tcaccagccc cgggaaccag accggctctg tcggcaccgc catcagcccg       960
     attcagatcc aggcgacgga ctcggcggga caggctctga cctatagcgc caccggactg      1020
     ccggcgggct tgtccatcag ctcctcgggc gtgatctccg gtacgccgac tgccgccggg      1080
     acctccgacg tcacggtcac cgcgagcgac tccagcggct ccggctcggc gacgttcacc      1140
     tggtcgatca gcggcggcgg caccaccacc ggggtctgtc acgcgaccta tgcccggacc      1200
     tccgaatggc ccggcgggtt caccgcgaat gtgacgatcg ccaacaccgg caccaccgcg      1260
     gtcaacggct ggaccctggg gtggagcttc cccggcgacc agaagatcac caacgcctgg      1320
     agcgccacgg ccacccagag cggctcgaac gtgacggcga ccaacgtcgc ctacaacggc      1380
     agcatcgctc ccggtggtac cacgtcgttc ggcttccagg ggacctacgg ctccaacgac      1440
     agcagcccca cggcgttcac gctcaatgga accgcgtgca gctga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page