(data stored in ACNUC7421 zone)

EMBL: CP001700.PE472

CP001700.PE472       Location/Qualifiers
FT   CDS_pept        540297..541307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0475"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; SMART:
FT                   cellulose-binding family II; KEGG: sco:SCO2291 secreted
FT                   acetylxylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69427"
FT                   /db_xref="GOA:C7PX76"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX76"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACU69427.1"
FT                   /translation="MRIRPRSWRRSLTSGLAAAALALAGALTVGVGAPVAHAATCGGYV
FT                   GLSFDDGPSNDHTPAILNALKQNGLRATMFNEGQYAAAYPAQVQAEINAGMWVGNHSYT
FT                   HPHLIQESQAQIDSEVSRTQQAIAAAGGGTPTLFRPPYGETNSTLRAVEAKYGLTEIIW
FT                   DIDSQDWNGASVSAIVAANGRLTNGQVILMHEWPANTLAAIPQIAQVLASHNLCPGMIS
FT                   PQTGRAVAPTGGSGGGGGGGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSTWTVTM
FT                   NMVSPAVVYNTWNVSATWPSQYVMVAKPNGSGNNFGVTITPNGQWTWPSVSCSTT"
     atgcgtatca gaccacgatc ttggagacgc tctctgacgt ccggactggc cgcggccgcg        60
     ctggcactgg ccggtgcgct caccgtcggc gtcggcgcgc cggtcgcgca tgccgcgacg       120
     tgcggcgggt acgtcggcct cagcttcgac gacggtccgt ccaacgacca caccccggct       180
     atcctcaacg cgcttaagca gaacggcctg cgggcgacga tgttcaacga gggccagtac       240
     gcggcagcgt atccggcgca ggtgcaggcc gagatcaacg ccggcatgtg ggtcggcaac       300
     cacagctaca cccatccgca cctgattcag gagagccagg cgcagatcga ctccgaggtc       360
     tcccgtaccc agcaggccat cgccgcggcc ggaggcggga cgcccacgct gttccgtccg       420
     ccgtacggtg agaccaactc aacgctgcgg gccgtcgagg cgaaatacgg tctcaccgag       480
     atcatctggg acatcgactc ccaggactgg aacggtgcca gcgtctccgc gatcgtcgcg       540
     gccaacggcc ggctcaccaa cggccaggtc atcctgatgc acgagtggcc cgcgaacacc       600
     ctcgccgcga tcccccagat cgcccaggtt ctggccagcc acaacctgtg tcccggcatg       660
     atctccccgc agaccggccg ggcagtggca ccgactggtg gtagcggcgg tgggggcggc       720
     ggaggcggcg gtggcggagg cggtggcagt tgtactgcaa cgctgtcggc cggctcgcag       780
     ggcagcaact ggtacaacct caatgtcgcg gtcaccggct cctccacctg gaccgtgacg       840
     atgaacatgg tgtcgccggc ggtcgtctac aacacctgga acgtcagcgc cacctggccc       900
     agccagtacg tgatggtcgc caaacccaac ggaagcggca acaacttcgg ggtcaccatc       960
     acccccaacg gccaatggac ctggccttca gtatcctgca gcaccacctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page