(data stored in ACNUC7421 zone)

EMBL: CP001700.PE473

CP001700.PE473       Location/Qualifiers
FT   CDS_pept        541555..542346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69428"
FT                   /db_xref="GOA:C7PX77"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX77"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6463"
FT                   /protein_id="ACU69428.1"
FT                   /translation="MSSPDTVIAALRSEYDLLAQQVAAFSDDDLAGPSAASEWDISEVL
FT                   SHLGSGAEINRATLQAALDGTAPGGREFNESVWDRWNAMSGRERADGFVAANRELTELY
FT                   ESLDAETRENLRIDMGFLPAPIDVATAGRMRLNELAMHSWDIRVASDVNATLAPQAVRE
FT                   LLHGEPDLTAWTSKPEHLDGESLVLHVTTSEPESDFALNLTTPVSTSFEVADKYDGTLT
FT                   LPAEAWLRLKVGRLAPQHTPTGIVTTGAADLDLLRKVFPGY"
     atgagtagcc ccgatacggt gatcgccgcc ctgcgcagcg agtacgacct tctggcccag        60
     caggtcgcgg cgttcagcga cgacgacctg gccgggccct cggccgcgtc cgagtgggac       120
     atctcggaag tcctcagcca cttgggcagc ggcgcggaga tcaaccgggc gacgctccaa       180
     gccgcgctcg acgggacggc gcccggcggc cgcgagttca acgagtctgt ctgggaccgg       240
     tggaacgcca tgtccggccg ggagcgcgcc gacgggttcg tcgcggcgaa ccgcgagctg       300
     accgaactgt atgaatcgct ggatgccgag acgcgggaaa acctgaggat cgacatgggc       360
     ttcctgcccg cgccgatcga cgtggcgacc gccgggcgca tgcgtctcaa tgagctggcc       420
     atgcactcct gggacatccg tgtcgcctcg gacgtgaacg ccacgcttgc gccccaagcc       480
     gtccgcgaac tcctgcacgg cgagccggac ctcaccgcat ggaccagcaa gcccgagcac       540
     ctcgacggcg agagcctggt cctccacgtc accacgagcg agccggagtc ggacttcgcc       600
     ctgaacctga ccaccccggt gagcaccagc ttcgaggtcg ccgacaagta cgacggcacg       660
     ctcacgctcc cggccgaggc ctggctgcgt ctcaaagtcg gacgtctcgc gccgcagcac       720
     acgccgaccg ggatcgtcac caccggcgcc gccgacctcg acctgctgcg caaggtcttc       780
     cccgggtact ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page