(data stored in ACNUC7421 zone)

EMBL: CP001700.PE474

CP001700.PE474       Location/Qualifiers
FT   CDS_pept        542651..543949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0477"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cms:CMS_0868 putative solute-binding transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69429"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX78"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU69429.1"
FT                   /translation="MTTRMRSAIAVFLGLGTMLAATGCAGSSGGGGGGSSDGKVTVTVW
FT                   ENATNGPDGLQYFQSAAKQYQALHPNVTISFQTIQNEALDGKLQTALNSNSAPDVFFQV
FT                   GGGKMRAQVAAGELQPLNLTDADKTDVGAAALSGSTLDGKVYMMPVDTQPEGIYYSKNL
FT                   FQQAGITTTPTTIDELEADVAKLKAINVAPIAVGAKDAWPAAHWYYNFALRECSQSVMA
FT                   STAKSLKFTDPCWTTAGNALATFLKTNPFPAGFLTTAAQQGAGSSAGLLANHKAAMELM
FT                   GSWDPGVIASLTPDQKPLPDLGWFPFPAVAGGQGDPSAIMGGNSAYSLSKKAPKEAFGF
FT                   LEFMLTKDQQEAYSKAFQSIPVNPASQDVVTTSYNISALQAFNKAAYSMQYLDTQFGLN
FT                   VGNALNTAVVNLMAGRGSAAEIVTQANAAAAKG"
     gtgacgacga gaatgcgcag cgcgatagcc gtcttcctcg gcttgggcac gatgctcgcc        60
     gccaccggct gtgccggcag cagcggcggc gggggcggcg gttcgtccga cggcaaggtg       120
     acggtgaccg tctgggagaa cgcgacgaac ggcccggacg gcctgcagta cttccagagc       180
     gccgcgaagc agtaccaggc cctgcacccg aacgtcacga tctcgttcca gacgatccag       240
     aacgaggcac tcgacggcaa gctccagacc gccctcaact cgaacagcgc gccggacgtc       300
     ttcttccagg tcggcggcgg caagatgcgg gcccaggtcg ccgccggcga actccagccg       360
     ctgaacctca ccgacgcgga caagaccgac gtcggcgcgg cggccctgtc cggcagcacg       420
     ctcgacggca aggtctacat gatgccggtc gacacgcagc ccgagggcat ctactacagc       480
     aagaacctgt tccagcaagc cggcatcacc acgacgccca cgacgatcga cgagctcgaa       540
     gccgacgtcg ccaagctcaa ggcaatcaac gtcgcaccga tcgcagtcgg agccaaggac       600
     gcctggcccg ccgcgcactg gtactacaac ttcgccctcc gcgagtgcag ccaatccgtc       660
     atggcgagca ccgccaagtc gctcaagttc accgacccat gctggaccac agccggaaac       720
     gccctggcca cattcctcaa gaccaacccc ttcccagccg gcttcctgac aaccgcagcc       780
     cagcaaggcg ccggctcctc agcgggccta ctcgccaatc acaaggcagc catggagctc       840
     atgggctcct gggaccccgg cgtaatcgcc agcttgaccc cggaccagaa gccgctcccc       900
     gacctgggct ggttcccgtt ccccgcagta gccggcggcc aaggcgaccc ctccgcaatc       960
     atgggcggca actccgccta ctcgctgtcc aagaaggcac caaaggaggc cttcggcttc      1020
     ctggagttca tgctgaccaa ggaccagcag gaggcatact ccaaggcctt ccaatcaatc      1080
     ccggtgaacc cggcgtccca ggacgtcgtc accacctcct acaacatctc agcactgcaa      1140
     gccttcaaca aggccgccta ctcaatgcag tacctcgaca cccagttcgg cctaaacgtc      1200
     ggcaacgccc taaacaccgc cgtcgtcaac ctcatggccg gccgaggcag cgccgccgaa      1260
     atcgtcacgc aggccaacgc cgccgcggcg aagggctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page