(data stored in ACNUC7421 zone)

EMBL: CP001700.PE475

CP001700.PE475       Location/Qualifiers
FT   CDS_pept        complement(544071..545078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0478"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bsu:BSU07300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69430"
FT                   /db_xref="GOA:C7PX79"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX79"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU69430.1"
FT                   /translation="MKVSIIMATYDKRDYLEYTLASLAGQTHSDFELVLCDDGTEGGVA
FT                   DLIAPYRDRFAIVPLVQANAGRAAARNTALARASGDLVVFSDDDRILPPEFLAAHVSAH
FT                   SAGGEEDLAVIGWKKRGVTVWIPRMLPVDESDLTTLARRVGGVEPLASPLRTIEPGDVA
FT                   VSYPVAVSRMELGDEPDNYHAIVDKYGDELADFRFGWVLATTANLSVPRALLDKIGGFD
FT                   DGFQGWGVEDTDLSYRLWQAGTRFRIERAAVNHHQVHPIGTGNALLDNRRRRAALMANV
FT                   EFFCRKHQTLEAYLFKRRWEHAMTLDEANRLLAEVEAGVGHSVREELLRLYAAA"
     gtgaaggtca gcatcatcat ggccacctac gacaagcggg actatctgga gtacacgctc        60
     gcgtcgctgg ccgggcagac gcactccgac ttcgagctcg tactctgcga cgacggcacc       120
     gagggcggcg tggccgatct gatcgcgccg taccgggacc gcttcgccat cgtcccgctc       180
     gtccaggcga acgccggccg cgcggcggcg cggaacacgg cgctggctcg agcctcgggc       240
     gacctggtgg tgttcagcga cgacgaccgg atcctgccgc cggagttcct cgcggcgcac       300
     gtgtccgcgc acagcgccgg gggtgaggag gacctggcgg tgatcggctg gaagaagcgc       360
     ggggtcaccg tgtggatccc gcggatgctc ccggtcgacg aaagcgacct cacgaccctg       420
     gcccggcgcg tgggcggcgt cgaacccctg gcatccccgc tgcgcaccat cgagccgggc       480
     gacgtggcgg tctcctaccc ggtggccgtc agccgcatgg aactcgggga cgaaccagac       540
     aactaccacg cgatcgtcga caagtacggg gacgaactgg cggacttccg cttcggctgg       600
     gtcctcgcga cgacggccaa cctgtcagtg ccgcgcgcgc tcctcgacaa gatcggcggc       660
     ttcgacgacg gattccaggg ctggggcgtc gaggacaccg acctgagcta ccggctgtgg       720
     caggccggca cccgcttccg gatcgagcgc gcggcagtga accaccacca ggtccatccc       780
     atcggcaccg gcaacgccct gctcgacaac cggcgccgcc gggcagcgct gatggcgaac       840
     gtcgagttct tctgccgcaa gcaccaaacg ctggaggcat acctgttcaa gcggcgctgg       900
     gagcacgcga tgacgctcga cgaggcgaac cggctgctgg ctgaagtgga ggccggcgtc       960
     ggccactcgg tgcgggagga gctgttgcgg ttgtacgccg cggcgtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page