(data stored in ACNUC7421 zone)

EMBL: CP001700.PE476

CP001700.PE476       Location/Qualifiers
FT   CDS_pept        complement(545134..546588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0479"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: amr:AM1_E0096
FT                   cytochrome P450 family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69431"
FT                   /db_xref="GOA:C7PX80"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX80"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACU69431.1"
FT                   /translation="MTEIAERPPVPVPVPVPGPEPARLLGRRLNRQRYFKDPVGYTCAV
FT                   YHRFGPVSGLTHGDRQHFFAFGAEQNRTVLLDDGTFHTAFEYATPPMIKAARRGIGLLN
FT                   MNGPPHQAARRLVAPAFRASAVRGYGEAVALITRAEVDSWSQGDRFDLSVRMRELTLRI
FT                   VCLVLFGVDIAEDARPLGRLVQRMLALRYFAPSIRYFPFNVPGAPLARLLGVIRDLDDA
FT                   LDGIVATRRDGGGRDLLSGLMEARAEDGGPALSADELIGHLTTFIVAGHETTSNTLSWA
FT                   FAILDQHPDIADALTGEVGALPEDVESRLAEIDKLPLLDAVVKEVLRLMPPGPNTSRVA
FT                   VAPTELGGFEIPPGSQVVTSKFVTHRDESLFPDPLRFHPDRWATQGPVSVYQYLPFGVG
FT                   PHVCVGAAFATLEMKIILAEVLRRWSPRVADGADLSRDVGLMMAPKNGVSVILRPPGTP
FT                   RAGGRVVGDIHQMVRLTDRDIDRLGW"
     atgaccgaga tcgccgagcg tccgccggtg ccggtgcccg tgccggtgcc gggaccggaa        60
     cccgcgcgcc tgctgggccg gcggctcaac cgccagcggt atttcaagga ccccgtcggc       120
     tacacctgcg ctgtctacca ccggttcggc ccggtcagtg gcctgacgca cggcgaccgg       180
     cagcacttct tcgcgttcgg cgccgagcag aaccggaccg tcttgcttga cgacggcacg       240
     ttccacaccg ccttcgaata cgccacgccg ccaatgatca aggcggcgcg gcgcggcatc       300
     ggcctgctca acatgaacgg cccgccgcac caggcggccc gccgcctggt cgccccggcc       360
     ttccgcgcct cggccgtccg cggctacggc gaggcggtcg cgctcatcac ccgcgccgag       420
     gtggacagct ggagccaggg ggaccggttc gacctcagcg tgcgcatgcg ggagctgaca       480
     ctgcgcatcg tctgcctcgt cctgttcggg gtcgacatcg ccgaagacgc gcggccgctc       540
     ggccgcctgg tgcagaggat gctggcgctg cgctacttcg ccccgtcgat ccggtacttc       600
     ccgttcaacg tccccggcgc gccgctggcc cggttgcttg gcgtgatccg cgacctcgac       660
     gacgcgctcg acggcatcgt ggccacccgt cgcgacggcg gcgggcgcga tctgctgtcc       720
     gggctcatgg aggcgcgggc tgaggacggg ggtcccgcgc tgagcgccga cgagctgatc       780
     gggcacctga ccacgttcat cgtggccggc cacgagacca cgtccaacac cctgtcctgg       840
     gctttcgcga ttctggatca gcatcctgat atcgccgacg ccctgaccgg ggaggtcggc       900
     gccctgcccg aggacgtcga gtcccgtctg gcggagatcg acaagctgcc gctgctcgac       960
     gcggtggtca aggaggtgct gcggctcatg ccgccgggac cgaacacctc gcgggtggcg      1020
     gtcgcgccga ccgagctcgg cggcttcgag atcccgccgg gcagccaggt cgtcaccagc      1080
     aagttcgtca cgcatcgcga cgagtcgttg ttccccgacc ccttgcgctt ccatcccgac      1140
     cgctgggcga cgcagggccc tgtctcggtg taccagtacc tgccgttcgg cgtgggcccg      1200
     catgtgtgcg tgggcgcggc gttcgccacc ctggagatga agatcatcct cgccgaggtc      1260
     ctgcggcgct ggagcccgcg ggtcgccgat ggcgccgacc tctcccgcga cgtcgggctc      1320
     atgatggcgc ccaagaacgg cgtctccgtc atcctcaggc cgcccgggac gccgcgtgcc      1380
     ggcggccgtg tggtcggcga catccaccag atggtccgcc tgacggaccg cgacatcgac      1440
     aggctcggct ggtga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page