(data stored in ACNUC7421 zone)

EMBL: CP001700.PE477

CP001700.PE477       Location/Qualifiers
FT   CDS_pept        complement(546640..547785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69432"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX81"
FT                   /inference="similar to AA sequence:KEGG:SGR_588"
FT                   /protein_id="ACU69432.1"
FT                   /translation="MIRDGALVLSAAVMTHPDREAEVRRFVERHPELELRIAVDPEPER
FT                   GHSLGTALLAWSMVEPGATHHLVLQDDVVLCEGFVDLMVAAVRTHPDAAVSMFAEWGAR
FT                   AGTLVRLALLRGQGYAAVADPYIPTQALVLPAAQAADFAEKGRTETEPDDIALLNHLRR
FT                   TGTRGVVVAPNLVQHQDRPSLTGNTFQGPRLSACFVPDPPAGLLAALEPTVAGADLDFL
FT                   PHVSWMRLIGEWFYCGPDEEAVWTGWPLAERLPPELDAAWLRSQYDAHLRQSDRREEIR
FT                   KTLSDTVLFEVWLACLALGLVSGVTPAGVVARAADPLWQAALATVLPGAFRRYLPAPVL
FT                   DRLGPYAAELFGLAIHEGATVAAGGEQDTVHAIAHRGARWP"
     gtgatccgcg acggtgcgct ggtgctttca gcggcggtga tgacacaccc ggatcgcgaa        60
     gccgaggtcc ggcggttcgt cgaacgccat cctgagctgg agctgcgcat cgcggtcgac       120
     cccgaacccg aacgcgggca cagtctgggc acggcgctgc tcgcctggtc catggtcgag       180
     ccgggcgcca cccaccacct ggtgctccag gacgacgtcg tcctgtgcga aggcttcgtc       240
     gatctgatgg tcgccgcagt ccgcacccat ccggacgcgg cggtcagcat gttcgccgag       300
     tggggcgcgc gggccggaac cctggtccgc ctggcactgt tgcgcgggca gggctacgcg       360
     gccgtcgcag acccctacat tcccacccaa gcgctggtgc tgcccgccgc gcaagcggcc       420
     gacttcgccg agaagggccg caccgagacc gagcccgatg acatcgcgct gctgaaccat       480
     ctgcggcgca ccggaacgcg gggcgtcgtc gtggcaccga atctcgtgca gcatcaggac       540
     cggccgagcc tgaccggcaa cacgttccag ggaccccggc tgtcggcctg cttcgtcccc       600
     gaccccccgg ccggactgct ggccgcgctg gagccgaccg tcgccggagc cgacctcgac       660
     ttcctgccgc acgtctcctg gatgcggctg atcggcgaat ggttctactg cggccctgac       720
     gaggaggcgg tctggaccgg ctggccgttg gccgagcgct tgccgccgga attggacgcc       780
     gcctggctac gcagccagta tgacgcgcac ctccgccaga gcgatcggcg ggaggagatt       840
     cgcaagaccc tgagcgacac ggtcctgttc gaggtgtggc tcgcctgcct cgccctcggc       900
     ctggtgagcg gtgtcactcc ggccggcgtc gtggcccgcg cagccgaccc gctgtggcag       960
     gcggcgctgg cgacggtcct tcccggcgcc ttccgccgct atctgcccgc gccggtgctc      1020
     gaccgcttgg gtccgtacgc ggcggaatta ttcggcttgg ccatccacga aggcgccacg      1080
     gtcgcggccg gcggcgagca ggacaccgtg catgcgatcg cccaccgcgg ggcgcggtgg      1140
     ccttga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page