(data stored in ACNUC7421 zone)

EMBL: CP001700.PE478

CP001700.PE478       Location/Qualifiers
FT   CDS_pept        complement(547782..549041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0481"
FT                   /product="glycosyltransferase 28 domain protein"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   lxx:Lxx06832 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69433"
FT                   /db_xref="GOA:C7PX82"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX82"
FT                   /inference="protein motif:PFAM:PF04101"
FT                   /protein_id="ACU69433.1"
FT                   /translation="MTLFESPRLRVLFVAFSRSSLGHIVRSTTAAARFAADGHDVAVAC
FT                   HEEVRHIPEKAGLAWLPIEEIGPAPAWRGMDDPEQLRAFVRTRLASPEYVSASLEDELR
FT                   VIDLFRPDVVIADMRNTAGVAASMRGVTAFTLHNLRLFQHPMHVVLPEVLVTLDQLGVE
FT                   QAHARHVLGSTVLVPDIAEIDGLSDVPRDTAALICSLTDEIRHLGPLLSPELLSVAARA
FT                   SESESGPGPRATENRRRLLHVTLGGSGVGDQQIRRVVEAVAGLGLDIGVTLGAESLQDQ
FT                   VTALEDELAAVAGDSAVTVTGFRHDVVERVAAADAAVVHGGHGSIIEALVCGTPLVFLP
FT                   GSLEQRENARKIRELGLGVVLAPDDDAAAVRAKVVKALSLKETPGPRRFARALVAADGA
FT                   GRLVDYVTSSQAIRTAVAAP"
     gtgacgttgt tcgagagccc ccggctcagg gtgctgttcg tggccttcag ccgcagcagc        60
     ctgggccaca tcgtccggtc cacgacggcc gccgcccgct tcgccgccga cggacacgac       120
     gtcgcggtgg cctgccacga ggaggtccgg cacatcccgg agaaggccgg cctggcctgg       180
     ctgccgatcg aggagatcgg gcccgctccg gcgtggcgcg gcatggacga ccccgagcag       240
     ctgcgggcct tcgtccggac ccggctggcc agtccggagt acgtctcggc gtcgctggag       300
     gacgagctgc gcgtcatcga cctcttccgg cccgacgtcg tcatcgcgga catgcgcaac       360
     accgcgggcg tcgcggcgtc catgcgcggg gtgacggcgt tcacgctcca caacctccgg       420
     ctgttccagc acccgatgca cgtggtgctc cccgaggtcc tggtgacgct cgatcagctg       480
     ggcgtcgagc aggcccacgc gcgccacgtc ctgggcagca cggtcctggt gccggacatc       540
     gccgagatcg acggcctctc ggatgtccct cgcgacaccg ccgcgctcat ctgctccctg       600
     accgacgaga tccggcatct cggaccgctg ctgtcgccgg agctgctgtc cgtcgccgca       660
     cgagcgtccg agtccgagtc cgggccggga ccgcgggcca ccgaaaaccg gcgccgcctg       720
     ctgcacgtca cgctcggcgg cagcggcgtc ggcgaccagc agatccggcg cgtcgtcgag       780
     gcggtcgccg gcctcggcct ggacatcggg gtgacgctcg gcgccgagtc gctccaggac       840
     caggtgaccg cgctggagga cgagctcgcg gcggtcgcgg gcgactccgc cgtcaccgtc       900
     accgggttcc ggcacgacgt cgtggagcgc gtcgcggccg ccgacgcggc ggtcgtgcac       960
     ggcggccacg gctcgatcat cgaggccctg gtctgcggca cgccactggt gttcctgccc      1020
     ggttcgctgg aacagcggga aaacgcgcgc aagatccggg aactcggcct gggtgtcgtg      1080
     ctcgcacccg acgacgacgc ggcggcggtc cgcgccaaag tcgtcaaggc cctgagtctg      1140
     aaggagactc cagggccgcg ccgcttcgcg cgggccctcg tggcggccga cggcgccgga      1200
     cgcctggtcg actacgtcac cagctcccag gcgatccgca ccgcggtggc ggcgccgtga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page