(data stored in ACNUC7421 zone)

EMBL: CP001700.PE479

CP001700.PE479       Location/Qualifiers
FT   CDS_pept        complement(549102..550478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0482"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   lxx:Lxx06835 major facilitator superfamily H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69434"
FT                   /db_xref="GOA:C7PX83"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX83"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69434.1"
FT                   /translation="MERGARVDGDSVPAESAGSGAAAPAERRAPEPKPEPEPEPADKRS
FT                   VLRDHDFRALLASKSASTVASAVTWVVLPLYVYTVSRSSLLTAVASAMNVIPYVLFGIV
FT                   AGALVDRSSPRRVMIVVELGNAAIMLTVPALHAGHVLSIAVLCAVGFTSATAFVWFDVA
FT                   SSTLVPSVVGKTAVFHANGFLWSVATLVQAVAAPTGFFLLNRWGIGWTFAALSLFYALS
FT                   ALFLAMVRMPSAASGGVAAGAPASAGGPGRAMLEGLQFIVREPTIRLLTIIGMGSGISA
FT                   GAVYGMIVVFANRALHLGTDDYRISWILAASSAGALLASFAAPRLRGLPPIPSVAGLLV
FT                   VDTVLMAGYALSADWQMALGAILLWNLAHTTLMIVSISLRQVLAPPRLQGRVNAAGKML
FT                   AWGSVPLGSALCGALTGWIGSRQASLLLVAPIAASLVLAAAMVVRRPAVTDPSKASESP
FT                   "
     atggagcgcg gcgctcgcgt cgacggtgac agcgtcccgg cggagtcggc cgggtcgggg        60
     gctgcggcgc cggccgagcg tcgggcaccg gaaccgaaac cggaaccgga accggaaccg       120
     gccgacaaac gctccgtcct gcgcgatcac gacttccgcg cgctcctggc cagtaagtcc       180
     gcctcgaccg tggcctcggc cgtgacgtgg gtcgtgctgc cgctgtacgt ctacacggtc       240
     tcgcgttcct cgctgctgac ggctgtcgcc agcgcgatga acgtcattcc ttatgtgctc       300
     ttcggcatcg ttgccggggc gttggtcgac cggtcctcgc ccaggcgggt gatgatcgtt       360
     gtcgagctgg gtaatgccgc gatcatgttg acggtgcctg cgcttcatgc ggggcacgtc       420
     ttgtcgatcg cggtgctgtg tgcggtgggc ttcacgtcgg cgactgcttt cgtctggttc       480
     gacgtcgcgt cgtccacgct cgtgccctcg gtcgtcggca agactgctgt gttccacgcc       540
     aacggattct tgtggagcgt ggccactttg gtacaagcgg tggccgcgcc gaccggtttc       600
     ttcctgctca accggtgggg tatcggctgg acgtttgccg cgctctcgct cttctacgcg       660
     ctctcggcgc tcttcctggc catggtccgt atgccgtccg cggcctccgg cggcgtcgcg       720
     gcgggtgccc cggcgagcgc gggcgggccg ggccgggcga tgctggaggg cctgcagttc       780
     atcgtccggg agccgactat caggcttctg acgatcatcg gtatgggctc ggggatcagt       840
     gcgggtgcgg tgtacggcat gatcgtcgtg ttcgccaacc gggcgttgca cctgggcacc       900
     gacgattacc ggatctcctg gattctcgcc gcttccagcg cgggtgccct gctggcctcg       960
     ttcgccgctc cgaggctgcg ggggctgccg ccgattccga gcgtcgccgg gctgctcgtc      1020
     gtcgacacgg ttctgatggc cggctacgcg ctgtcggccg actggcagat ggcgctgggc      1080
     gcgatcctgc tgtggaacct ggcgcacacc accttgatga tcgtcagcat ctccctgcgt      1140
     caggtcctgg cgccgccgcg gcttcagggc agggtcaacg cggccggcaa gatgctcgcc      1200
     tggggcagcg ttccgctggg ctcggccctg tgcggcgccc tgactggctg gatcggcagc      1260
     cgccaggctt cgctgctgct cgtcgcgccg atcgcggcca gcctggtgct cgccgccgcc      1320
     atggtcgtac gccggccggc cgtgacggac ccgtcgaagg cttccgagag cccctga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page