(data stored in ACNUC7421 zone)

EMBL: CP001700.PE48

CP001700.PE48        Location/Qualifiers
FT   CDS_pept        complement(49198..49590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR4"
FT                   /inference="similar to AA sequence:KEGG:SGR_3310"
FT                   /protein_id="ACU69003.1"
FT                   /translation="MRRRRPRDAGYATVEAALAIPSLVLFTVALAGILTGLATQIRCVD
FT                   AARLGARAAARGEPAAQIQGAVTQAAPGSSIHITTENGLIHVSVAAPVAAMPLLRAFTV
FT                   HAEAYEADEATLEGGEEPHAAAEPRP"
     atgcggcgcc gaagaccccg ggacgccggc tacgccacgg tcgaggcggc gctggccatc        60
     ccgagcctgg tcctgttcac cgtggcgctc gccgggatcc tgaccggcct ggcaacacag       120
     atccgctgcg tcgacgccgc acgcctcggc gcccgagccg ccgcacgcgg cgaacccgcg       180
     gcacagatcc aaggcgccgt aacccaagca gcaccgggct cctcgatcca catcactact       240
     gagaacggcc tgatccacgt ctcggtcgcc gccccggtag ccgccatgcc gctactgcgg       300
     gcgttcaccg tgcacgccga ggcctacgaa gccgacgaag caaccctgga aggaggtgag       360
     gaaccccatg ccgccgccga accccgcccg tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page