(data stored in ACNUC7421 zone)

EMBL: CP001700.PE480

CP001700.PE480       Location/Qualifiers
FT   CDS_pept        complement(550499..550663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69435"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69435.1"
FT                   /translation="MSTSMFRPARRTRFPVHVQTGGAQAVEDDDEGLDSLYRLMPIPRS
FT                   VQPRVGITS"
     atgtccacat cgatgttcag accggcacgg cgtacccgct tcccggtgca cgtccagacc        60
     ggcggagcgc aggcggtcga ggacgacgac gaaggtttgg actcgctgta ccggctgatg       120
     ccgatcccgc gctccgtcca gccccgtgtg ggaatcacgt cgtga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page